KEGG   Curtobacterium sp. MR_MD2014: NI26_14715Help
Entry
NI26_14715        CDS       T04180                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cum  Curtobacterium sp. MR_MD2014
Pathway
cum00564  Glycerophospholipid metabolism
cum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NI26_14715
Enzymes [BR:cum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NI26_14715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AIV41030
UniProt: A0A0N7A0S5
LinkDB All DBs
Position
complement(3169102..3171030)
Genome map
AA seq 642 aa AA seqDB search
MAKPASSTTQTSTDATSAGAESTVEDARHATAPSASVGFDPAAKLGPEERAAAIEAMKTR
ELDVLVVGGGIVGGGSALDAVTRGLSVGIVEARDWGSGTSSRSSKLVHGGIRYLEQLNFA
LVREALIERGLLLQRIAPHLVKPVRFLYPLNHRVWERFYIGIGMAMYDVFSWSGGRPPGV
PHHRHLSRKQVLKNMPGLKKDAFVGGMTYYDAQVDDARYVASLVRTAASYGAHAASRVRI
EGFIKVGERVVGAHAHDIQTGEKFDIRAKQVVNATGVWTDDTQAMVGTRGQFKVRASKGV
HLVIPRDRFQSNTGMILRTEKSVLFVIPWGRHWLVGTTDTDWNLDKAHPAATAADIDYIL
EHVNKVLAVPLTREDVEGVYAGLRPLLAGESDQTSQLSREHVVAHTAPGLVVVAGGKWTT
YRVMGKDAIDEAVAAMDGKIPSSTTEDIPLVGAEGYPAAWNRRGRTARQFGVHKVRIEHL
LNRYGTQATEVLQLVEQDPSLAEPLPQADDYIGAEVVYAASHEGALHLEDVLARRTRISI
EAWDRGEEAAPVAAKLMAGVLGWDQETTEHEVSNYLKRVAAERESQLQPDDESADRVRLE
APDIAFGFDEDDVVVGGGRSSGADGAKATDEQVEGEKTSEPR
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggccaagccagccagcagcaccacgcagaccagcacggacgcgacgagcgcaggtgcc
gagagcaccgtcgaggacgcccggcatgccacggcaccgagcgcgagcgtcggcttcgac
ccggcggccaagctcggtccggaggagcgcgccgccgcgatcgaggcgatgaagacccgg
gagctcgacgtcctggtggtcggcggcggcatcgtcggcggtggcagcgcgctcgatgcc
gtcacccgcggcctgagcgtcggcatcgtcgaggcacgcgactggggctcggggacgtcg
agccgctcgtcgaagctcgtgcacggcggcatccgctacctcgagcagctgaacttcgcg
ctcgtccgcgaggccctgatcgaacgcggcctgctgctgcagcgcatcgctccgcacctg
gtgaagcccgttcgcttcctctacccgctcaaccaccgcgtgtgggagcgcttctacatc
ggcatcggcatggcgatgtacgacgtgttcagctggtccggcggtcgtccgcccggggtc
ccgcaccaccggcacctcagccgcaagcaggtcctcaagaacatgccgggcctgaagaag
gacgccttcgtcggcggcatgacctactacgacgcccaggtcgacgacgcccgctacgtc
gcgtcgctcgtgcgcaccgcagcgtcgtacggcgcgcacgcggcgagccgggtccgcatc
gaggggttcatcaaggtcggggagcgggtggtcggggcgcacgcgcacgacatccagacg
ggcgagaagttcgacatccgggcgaagcaggtcgtgaacgcgacgggcgtctggaccgac
gacacccaggcgatggtcggcacccgcgggcagttcaaggtgcgggcgtcgaagggcgtg
cacctcgtgatcccgcgcgaccgcttccagtcgaacaccggcatgatcctccgcaccgag
aagagcgtgctgttcgtcatcccgtggggccggcactggctcgtcggcacgacggacacc
gactggaacctcgacaaggcccacccggcggcgaccgcggcggacatcgactacatcctc
gagcacgtgaacaaggtcctcgcggtgccgctcacccgcgaggacgtcgagggcgtctac
gccggcctccgaccgctgctcgcgggcgagtcggaccagacgtcgcagctcagccgtgag
cacgtcgtcgcgcacaccgctccgggcctggtcgtggtcgcgggcggcaagtggacgacc
taccgcgtgatgggcaaggacgccatcgacgaggcggtcgcggcgatggacggcaagatc
ccgtcttcgacgaccgaggacatcccgctggtcggtgccgagggctacccggcggcctgg
aaccgtcgcgggcgcaccgctcggcagttcggcgtgcacaaggtccggatcgagcacctg
ctcaaccggtacggaacccaggccaccgaggtgctgcagctcgtcgagcaggacccgtcg
ctcgccgagccgctgccgcaggcggacgactacatcggtgccgaggtcgtctacgcggcc
tcgcacgagggcgccctgcacctggaggacgtcctcgctcgccgcacccgcatctcgatc
gaggcgtgggaccgcggagaagaggcggccccggtcgccgcgaagctcatggccggcgtg
ctcgggtgggaccaggagacgaccgagcacgaggtgtcgaactacctgaagcgcgtcgcc
gccgagcgcgagtcgcagctgcagcccgacgacgagtcggccgaccgggtgcgcctcgag
gcgccggacatcgcgttcggcttcgacgaggacgacgtggtggtcggcggtggccggtcg
agcggtgccgacggcgcgaaggcgacggacgagcaggtcgagggcgagaagacgagcgaa
ccgcggtag

DBGET integrated database retrieval system