KEGG   Corynebacterium ulcerans 210932: Cul210932_0051Help
Entry
Cul210932_0051    CDS       T03406                                 

Gene name
pknA
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cun  Corynebacterium ulcerans 210932
Brite
KEGG Orthology (KO) [BR:cun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cun01001]
    Cul210932_0051 (pknA)
Enzymes [BR:cun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cul210932_0051 (pknA)
Protein kinases [BR:cun01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cul210932_0051 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase Grp7_allergen
Motif
Other DBs
NCBI-ProteinID: AIT88032
UniProt: A0A0M4KXP5
LinkDB All DBs
Position
complement(46858..48378)
Genome map
AA seq 506 aa AA seqDB search
MSTDYNSPDPALQALIGDDYRLQWVVGTGGMSTVWLADDTRNQREVAVKVLRPEFSDNNE
FLSRFRNEALASENILSENVVQTFDYRELTDPSGRTLCFIVMEYVRGESLADMLARKGSL
DEHLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGQVKITDFGIAKAAAAVPLTR
TGMVVGTAQYVSPEQAQGKDVTEASDVYSLGVVGYEMLAGARPFTGDSSVSVAIAHINQA
PPALPTTVSAPARELIGIALRKDPAHRYADGNELALAVSATRMGQRPPQPQSAQLQQIAP
EPTPTASTHALGQTAQPTTVIPATGEVPQTVAAGQVAGPRTGYNAAPATIPPEENKKSSS
GVGTGLAVGVLLAALFGAGIWAASQGLFGDVMGGSDQPSSSVNPETITATVTETPTIREE
PRPIQRPQETPTPTSEPSEFPDASESVVPLPSTDNPRTAPTVDLNEGSQIPSTHRNPAPT
PTRGNGSDPITDLLNSLNAPEQGGAP
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagattacaattctccagatcccgcgctccaggccctcatcggcgacgattat
cgtctccagtgggtcgtgggtaccggcggcatgtctacggtatggcttgccgacgacacc
cgtaaccagcgcgaggtggctgtcaaagttctgcgccccgagttttctgacaacaacgag
tttctctcccgctttcgtaatgaggcgctagccagcgagaacatcctctcagaaaacgtt
gtacaaacttttgattaccgcgaactcaccgacccctctggccggacgctgtgcttcatc
gtcatggagtatgtgcgtggtgaatccctcgcagacatgctggcgcgcaaaggcagcctc
gacgagcaccttgccctcgacgtccttgaacaagcagctcatggcttgtccatcatccat
aggatgggcatggttcaccgggatattaagcccggaaacctcctgattactcagaatggc
caagtaaaaatcaccgattttggtatagctaaggccgcggcggctgtcccactgacccgc
acgggcatggtggtgggaactgcacagtacgtctcgcctgaacaggcccaaggcaaagac
gtcactgaagcctctgatgtatattccctgggtgttgtcgggtatgagatgctcgctggc
gcgcgtcctttcactggtgattcttctgtctcagtggctatcgcccacatcaatcaggca
ccgccggctctgcctactacggtttcagccccggcgcgcgaactcatcggtatcgctttg
cgtaaagacccagcgcaccgatatgccgatggcaatgagcttgcactggcagtatccgca
acccgcatggggcaacggccgccacaaccacagtcagcacagcttcagcagatagcaccc
gagcccacgcctaccgcgtcaacgcacgcgttaggtcaaacggcacagcccaccactgtc
atcccagcgaccggggaggttccacagactgttgccgccggccaggtagcgggaccgcgc
actggttataatgcggctcctgccacgatcccaccggaagaaaataaaaagagttccagc
ggggtaggcactggccttgctgtgggggttctccttgcagcattgtttggcgctggcata
tgggctgctagccagggtctttttggtgatgtgatgggtggaagcgaccaacccagtagt
tcggttaaccctgagacgattaccgcaacggtaacggaaacgcctacgattcgggaagaa
ccgcggccaatccagcgcccgcaggagactcctacgccgaccagcgagccatcggagttt
cctgatgcctcggagtctgttgttccgcttccgtctacggataaccctcggacagcgccg
actgtagacctcaacgagggatcccagatcccttctactcatcgcaatccggctcccact
ccaacgcgcggaaacggttccgaccccatcaccgatctactgaacagtcttaatgcccca
gaacaaggaggtgccccatga

DBGET integrated database retrieval system