KEGG   Corynebacterium ulcerans 210932: Cul210932_1265Help
Entry
Cul210932_1265    CDS       T03406                                 

Gene name
ctaB
Definition
(GenBank) Protoheme IX farnesyltransferase
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
cun  Corynebacterium ulcerans 210932
Pathway
cun00190  Oxidative phosphorylation
cun00860  Porphyrin and chlorophyll metabolism
cun01100  Metabolic pathways
cun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cun00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cul210932_1265 (ctaB)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cul210932_1265 (ctaB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:cun01006]
    Cul210932_1265 (ctaB)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cun03029]
    Cul210932_1265 (ctaB)
Enzymes [BR:cun01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     Cul210932_1265 (ctaB)
Prenyltransferases [BR:cun01006]
 Compound prenylation
  Protoheme farnesyltransferase
   Cul210932_1265 (ctaB)
Mitochondrial biogenesis [BR:cun03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Cul210932_1265 (ctaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-ProteinID: AIT89211
UniProt: A0A0M5KQM3
LinkDB All DBs
Position
complement(1319835..1320767)
Genome map
AA seq 310 aa AA seqDB search
MEKIKAYIALTKPRVIELLLVATIPAMLQADRGHSNIGLILLTLLGGWMGAAAANTFNMV
ADSDIDQKMGRTRARPLVKHTVSNRHASIFAWILTVTSFLWLWLLCDSLLAGLFVMLTIF
FYIFVYTKHLKRKTHLNIVWGGAAGCMPVVVGWAVITDNAPVGTPAQWWQAIVLFLIIFF
WTPPHTWALAMKYKDDYARAGVPMLPVVREPVEVTRQIVWYTWATVITTFLIIPAAGWIY
GSIAVVSGIWFLIMAIRLHQGIKAGGEVKPLKLFILSNNYLSILFVGLSLDAVLGLETVG
QKLGWVTTFF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttggagaagatcaaggcctatatcgcgctgacaaagccaagggtcattgagctcctattg
gttgcaacaattccagccatgctccaagcggatcgtggacacagcaacattgggctgatt
ctgcttactcttttgggtggttggatgggagccgcggctgccaacacctttaatatggtc
gccgactcggacatcgatcagaaaatggggcgcacgcgcgcacgaccgttggtcaaacat
actgtgagcaatcgacatgccagcatctttgcctggatcctcacggtgacaagcttcctg
tggctctggttactatgcgattctttgctcgcaggtttgtttgttatgttgacaattttc
ttttacatttttgtctacaccaagcacctcaagcgtaaaacccatctcaatattgtgtgg
ggtggggcggctggctgcatgccagttgtggtcggctgggccgtgattacagataatgca
ccggtaggaacccccgcgcaatggtggcaagcgatcgtcttgttcttgattattttcttc
tggacaccgccgcacacatgggcattagccatgaagtataaggatgactacgcgcgagca
ggcgtcccgatgcttcccgtagtcagagagcccgtggaagtgacacgccaaatcgtgtgg
tacacatgggcgactgtgatcacaacgttcctcatcattcctgcggcaggttggatttat
gggagcatagctgtggtctcaggaatctggttcctcattatggcaatccggttgcaccaa
ggcattaaggccggtggcgaggttaaaccgctcaagctgtttattctttccaacaattat
ctgtcgatactctttgtgggcttgtcgctcgatgcagtgttgggactagaaactgttggt
cagaagttggggtgggtaacaaccttcttctaa

DBGET integrated database retrieval system