KEGG   Corynebacterium ulcerans 210932: Cul210932_1272Help
Entry
Cul210932_1272    CDS       T03406                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase (PEPC) (PEPCase)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cun  Corynebacterium ulcerans 210932
Pathway
cun00620  Pyruvate metabolism
cun00680  Methane metabolism
cun01100  Metabolic pathways
cun01120  Microbial metabolism in diverse environments
cun01200  Carbon metabolism
Module
cun_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cul210932_1272 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    Cul210932_1272 (ppc)
Enzymes [BR:cun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cul210932_1272 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIT89218
UniProt: A0A0M4L235
LinkDB All DBs
Position
complement(1328352..1331171)
Genome map
AA seq 939 aa AA seqDB search
MPVKATSAGPLSEQLVEDIRFLGTLLGEVIKEQEGTAAFDRVEAARQLAFKISRKEAQVE
DLVSLLKDISAADAISIIRAFSHFALLANMVEDLHDELGRLRRQEAGEEDPDSTLGATWK
KLAKAGVTSEDVSGLLGNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKERHAILSADPN
ALTATRLEENTRRIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYKLSLLTAIPEINKQV
ADHIQREYGVSSEDALRSLFIKPGSWIGGDHDGNPYVTAETLHYATTRAAETVLKFYARE
LHQLEHELSLSDRLTDVSPTLRVLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
TEAVEGSWYARHDAYSDPDELAADLDIIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFEQAHVTKHYRELDENEKIRVLTAELSSPRPLIPRDGASYSE
VTQRELDIIAEAKRAVDAFGAMMIPHSIISMAESASDILEPMVLLKEFGLICIQEGQLTG
HIDVIPLFETIDDLQNGAKILQDLWRIPLYRSYVEQRNNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVSMCKQHGVALRLFHGRGGTVGRGGGPSYDAILAQPHGAVQGSVRVTEQG
EIISAKYGSVGAARRNLEALASATLEASLLTIDQVEEQYPEAYEIMGEISRLSQRKYSRL
AHEDPGFIEYFTSSTPLEEIGDLNIGSRPSSRKQTQSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALHEWVEKGCVRTAELSADERLAILQKLNDSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFADISAEFDLTKTMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYREGDTDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaagctacgtctgcaggtccactatccgaacagcttgttgaggatatacgc
tttctaggtacacttttgggggaggtgatcaaagaacaagagggaacggcagcctttgac
cgagtcgaagcagcgcgacagctggcttttaaaatctcgcgcaaagaggcacaggttgaa
gacttagtatcactgctcaaagatatttcagcagcagacgcgatatcgattattagagcg
tttagccattttgcgttgctagcaaacatggtggaggacttgcacgatgaactgggtaga
ctccggcgacaagaagccggtgaagaagacccagattcaactttgggtgcgacctggaaa
aagcttgctaaggctggagtaacgagcgaagacgtgtccggtttactcggtaactttcaa
gttgccccggtgcttaccgctcaccctacggaaacccgtagacgtacgatttttgatgcg
caagagcatatgactactttgctcaaagaacgtcatgcgattctgagcgcagatccgaat
gcgctgacggctacgcgtcttgaagagaatactcgtcggattcgccggtggctgactctc
atctggcagaccgcgcttatccgggtggcccgtcctaggattgaggacgaggtagaagtt
ggattgcgatactataagctctccttgcttactgcgatccctgagatcaacaagcaagtg
gctgatcatatccagcgagaatatggtgttagctctgaagatgctttgcggtcgctattc
attaaacctggaagctggatcggtggcgaccatgacggtaacccgtatgtcactgcggaa
actctgcactatgcgacgacacgagcagccgagactgtattaaagttttatgcacgcgaa
ctgcatcaacttgaacatgagttatcgctgtcggataggttgactgatgtgagcccgact
ctgcgcgtgcttgctgatttaggacataacgacgtcccatcgcgggtcgacgagccttat
cgccgtgccgtccacggtgtgcgcggtagagtacttgctacgctagcttctcggattggt
acagaagcggtagaaggctcgtggtatgcccgtcatgatgcttattctgatccagatgag
cttgcagcagatttggatatcattgatgcttccttgcggagaacgcacgatgaactcatc
gcagatgatcgcttgttgcgcatcaggacagcggtatcaagctttggtttccatctctat
tcgatggatttgcgccaaaattctgagagctatgaggatgtgcttaccgagctctttgag
caagcccacgtaaccaagcactatcgcgaattggacgagaacgaaaagattcgcgtttta
actgctgagctatcgtcaccgagaccccttataccgcgcgatggtgcgtcatatagtgag
gtaacccagcgtgagctcgacattattgctgaggcaaagcgtgcagtagatgcttttggt
gcaatgatgatcccacattcgattatctcgatggcagaatctgcgagcgatatcctcgaa
ccgatggtcctcctgaaagaattcggattaatctgcattcaggaaggacaacttaccgga
cacattgacgtcataccgctttttgaaacgatcgatgatctgcaaaatggtgccaagatt
ctccaagatctatggcggataccgttgtatcgcagttatgtggagcaacgaaataatctt
caagaggtcatgcttggctattccgattccaataaagatggtggctatctcgccgcaaac
tgggctctgtatgctgccgaaactgatttagtaagcatgtgtaaacaacatggtgtagcg
ctgaggcttttccatggccgcggtggaaccgtaggacgcggcggcggtccctcttatgac
gctatccttgctcagccacatggtgctgtacagggcagtgtacgtgttacggaacaaggt
gagatcatctcagcaaaatatggttctgtgggtgcggctcgtcgtaacctagaagccttg
gcctcagccacgctggaggcgtcgctgcttacaatcgatcaggtagaagagcaatatcct
gaggcgtatgagattatgggtgaaatctcacgcttgagtcagcgaaagtattcgaggctt
gcgcatgaagaccctggttttattgagtacttcacatcctccacacctttggaagagata
ggcgaccttaacatcggctcgcgtccttcgtcgcgaaaacaaacccaaagtatcgacgat
ttacgcgcaattccatgggtgctcagctggtcgcagtcccgtgttatgctgcccggctgg
tatggagtaggcagcgctttgcatgaatgggtagaaaaaggctgtgtgcgcacagcggaa
ctctcagcagatgagcgccttgctattttgcagaagcttaatgattcttggccgttcttt
tcttctgtgctgtctaatatggcgcaggtgatgagcaaagctgagatgcaacttgcgaag
ctctattcaggattggtagcagatcaggaagctgcaaacagaatatttgctgatatttct
gccgaattcgatctcactaagacgatgttcctcaagatcaccggcttctcggggcttctc
gacgacaacccgatgcttgcacggtcagttcgctcgcgttacccgtatctgttgccactt
aatacactgcaactcgaaatgctacgtaggtatcgcgaaggtgatactgatccgaaggtg
gtgcatggcattcgcctagctatgaacggcttggctaccgcgctgcgaaattctggctag

DBGET integrated database retrieval system