KEGG   Corynebacterium ulcerans 210932: Cul210932_1384Help
Entry
Cul210932_1384    CDS       T03406                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cun  Corynebacterium ulcerans 210932
Pathway
cun00010  Glycolysis / Gluconeogenesis
cun00520  Amino sugar and nucleotide sugar metabolism
cun01100  Metabolic pathways
cun01110  Biosynthesis of secondary metabolites
cun01120  Microbial metabolism in diverse environments
cun01130  Biosynthesis of antibiotics
cun01200  Carbon metabolism
Module
cun_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cul210932_1384 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cul210932_1384 (ppgK)
Enzymes [BR:cun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cul210932_1384 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AIT89323
UniProt: A0A0M4KTB9
LinkDB All DBs
Position
1444387..1445139
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGEFVGDRIKILTPKPATPEAVAQTIFRIVTEAEWEG
PVGITLPSVIRNQVALSAANIDKSWINVDVQKLFTKTLGGRNVAVLNDADAAGIAEVTFG
EEQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMLVEGKEAEHLASSAAKDREELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWIPKLTIATPVVPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggtggatctgggattaaaggcgcccgtgtt
gatctggataccggtgaatttgtcggagacaggattaaaattttaacgcccaaacctgcc
acccccgaagcggtcgcccaaacgattttccgcattgttacagaagctgaatgggaagga
ccagtcggaataacgcttccctctgtaatccgaaatcaggtagctctttccgccgctaac
attgacaaatcatggatcaacgttgatgttcagaaactatttaccaaaaccctaggcgga
cgtaacgttgcggtgcttaacgacgccgatgcggcaggcatcgccgaggtcactttcgga
gaagaacaagctcgccgcggctccgccattttgctcactttaggaactggaatcggttcc
gctttctttatcaatggcgtcctattccccaatactgaactaggacacatgctcgtagaa
ggaaaagaagccgagcatctcgcttcatccgcagccaaagaccgtgaagagctaagctat
tccaaatgggccaagcgtgtttctaaagtcctcagcgaatatgaacggctcttttggcca
gacgtatttatcgtaggcggaggaatctcacgcaaagccgataaatggatccctaagctc
actatcgctacacctgtcgtacctgcaaagctacgcaatactgcaggaatcgtaggagca
gcaatggcggctgaccaaaatatccgcccctag

DBGET integrated database retrieval system