KEGG   Cupriavidus sp. USMAA1020: BKK80_10085Help
Entry
BKK80_10085       CDS       T04978                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00061  Fatty acid biosynthesis
cup00780  Biotin metabolism
cup01100  Metabolic pathways
cup01212  Fatty acid metabolism
Module
cup_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BKK80_10085
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BKK80_10085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cup01004]
    BKK80_10085
Enzymes [BR:cup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BKK80_10085
Lipid biosynthesis proteins [BR:cup01004]
 Fatty acid synthase
  Component type
   BKK80_10085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas DUF3942
Motif
Other DBs
NCBI-ProteinID: AOZ06142
LinkDB All DBs
Position
1:2271003..2271455
Genome map
AA seq 150 aa AA seqDB search
MTAADIDIRKILKLLPHRYPILLVDRVLEFEPGKRIKTLKNVTINEPYFMGHFPEQPVMP
GVLILEALAQSAGLLTFGAELERKEGALYYFVGIDGARFKQVVYPGDQLHLNVTVERYIR
GIWKFKAFATVDEKVACEAELMCTVKQAEA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagccgacatcgacatccgcaagatcctcaagctgctgccgcatcgctatccc
atcctgctggtggaccgggtactcgagttcgagccgggcaagcgcatcaagacgctgaag
aacgtcaccatcaacgagccctacttcatggggcatttccccgagcagccggtgatgccc
ggcgtgctcatcctcgaggcgctggcgcagtcggccggcctgctgacgttcggcgcggaa
ctcgaacgcaaggaaggcgcgctgtactacttcgtcggcatcgacggcgctcgcttcaag
caggtcgtctatccgggcgaccagctccacctgaacgtgaccgtcgagcgctacatccgc
ggtatctggaagttcaaggcttttgccaccgtcgacgagaaggtcgcgtgcgaggccgaa
ctgatgtgtaccgtcaagcaggccgaggcctga

DBGET integrated database retrieval system