KEGG   Cupriavidus sp. USMAA1020: BKK80_10510Help
Entry
BKK80_10510       CDS       T04978                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
cup  Cupriavidus sp. USMAA1020
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh YadA_anchor
Motif
Other DBs
NCBI-ProteinID: AOZ06217
LinkDB All DBs
Position
1:2374662..2376095
Genome map
AA seq 477 aa AA seqDB search
MQQRDKLFINGKWVAPHGAGHIDVIHSATEAVMGRIPEGSTRDAEDAILAARAAFDGWAA
TPAAVRAEYIRKIAEGLKARSEELAQLIAGEVGMPIKMARAIQVGGPVYNWGQAAKLLEN
FHFEEEVGNSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
VLAEVIEAAGLPPGVFNLVTGFGPVVGEVLASHPEVDMVSFTGSTRAGKRVSELASQTVK
RVALELGGKSASVILDDADLAAAVKGSVSACFLNSGQTCSAHTRMLVPRARYEEAKTIAK
QVAEAFTVGDPLQESTKLGPLISATQRERVTGYIRRGVNEGAELVTGGPDAPAGLDKGFY
VKPTVLGNVDPRATVAQEEIFGPVLSIICYDTEEEAVRIANDSIYGLGGGVWSGDEARAV
RVARRIRTGQVDINGGPFNMSAPFGGYKQSGNGREAGKYGLEEFLEYKSLQFKKPAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacgagacaaactcttcatcaatggtaaatgggtggccccgcacggcgcgggc
cacatcgatgtcatccattccgccaccgaggcggtgatgggccggattcccgaaggcagc
acccgtgatgccgaggacgccatcctggcggcccgtgccgcgttcgatggctgggccgcc
acgccggcggcggtgcgcgccgagtacatccgcaagattgccgagggcctgaaggcccgc
agcgaggaactggcgcagctgatcgccggcgaggtgggcatgccgatcaagatggcgcgc
gcgatccaggtcggcggcccggtctacaactggggccaggcggccaagctgctagagaac
ttccacttcgaggaggaggtcggcaattccctggtggtgcgcgagccggtcggtgtggtg
gcggcgatcacgccgtggaactacccgctcaaccagatcacgctgaaggtcgcaccggcg
ctggcggcgggctgcacggtggtgctgaagccgtccgaggtggcgccgctcaacgccttc
gtgctggccgaggtgatcgaggccgccggcctgccgccgggcgtgttcaacctggtgacc
ggcttcggtccggtggtcggcgaggtgctggccagccacccggaagtcgacatggtgtcc
ttcaccggttccacccgcgccggcaagcgcgtgtcggaactggcctcgcagacggtcaag
cgggtcgcgctggagctgggtggcaagtcggcctcggtgatcctggacgatgccgacctg
gcggccgcggtcaagggcagcgtcagcgcctgcttcctgaactccggccagacctgttcg
gcccacacccgcatgctggtgccgcgcgcccgctacgaagaggccaagaccatcgccaag
caggtggccgaagccttcaccgtgggggatccgctgcaggaaagcaccaagctcggaccg
ctgatctccgccacgcagcgcgagcgcgtgaccggctacatccgccgcggcgtcaacgaa
ggtgccgaactggtgaccggcggtccggatgcgccggcgggcctggacaagggcttctac
gtcaagccgacggtcctgggcaacgtcgatccgcgcgcgaccgtggcacaggaggaaatc
ttcggaccggtgctgtcgatcatctgctacgacaccgaggaagaggccgtgcgcatcgcc
aacgacagcatctacggcctgggcggcggcgtgtggtcgggtgacgaagcgcgcgccgtg
cgcgtggcgcgccgcatccgtaccggccaggtcgacatcaacggcggccccttcaatatg
tcggcgccgttcggcggctacaagcagtcgggcaacggccgcgaggccggcaagtatggc
ctggaggagttcctcgagtacaagtcgctgcaattcaagaagccggcggcctga

DBGET integrated database retrieval system