KEGG   Cupriavidus sp. USMAA1020: BKK80_18365Help
Entry
BKK80_18365       CDS       T04978                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKK80_18365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cup02000]
    BKK80_18365
Enzymes [BR:cup01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BKK80_18365
Transporters [BR:cup02000]
 Other Transporters
  Pores ion channels [TC:1]
   BKK80_18365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: AOZ07579
LinkDB All DBs
Position
1:4055621..4056247
Genome map
AA seq 208 aa AA seqDB search
MSTNRHITLFHAPNSRSAGARILIEELQAEHTLQVLDLKAMQQREPAYLALNPMGKVPAL
RHGDSIVTEQAAIFLYLAELYAERGLSPAPGDPLRGAYLRWMVFYGSCFEPAMVDRAMQR
EAGPASMSPYGSYEAVVGAIEQQLQPGPWLLGERFTAADVLWGSALGRICAFKLMPRSPA
VGAYLERFQARPAVQRAQALDAELAAKA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgaatcgtcatattacgctgttccacgcccctaacagccgctcggccggcgcg
cgcatcctgatcgaggaactccaggccgagcacacgctgcaggtactcgacctgaaggcc
atgcagcaacgcgaaccggcctacctggcgctcaacccgatgggcaaggtgcccgcgctg
cgccacggcgacagcatcgtcaccgagcaggccgcgatcttcctgtacctcgccgaactc
tacgcggagcggggcctgtcgcccgcgccgggggatccgctgcgcggcgcctacctgcgc
tggatggtgttctacggctcctgtttcgaaccggccatggtcgatcgcgcgatgcagcgc
gaagcgggcccggccagcatgtcgccctacggcagctatgaggccgtggtcggcgcgatc
gaacagcaattgcagccaggtccctggctgctcggcgaacgcttcactgcggcggacgtg
ttgtggggcagcgcgctcggcaggatctgcgctttcaagctgatgccgcgctcgccggcg
gttggcgcctacctggagcgcttccaggcgcggccggccgtgcagcgggcgcaagcgctg
gatgcggagctggccgcgaaagcctga

DBGET integrated database retrieval system