KEGG   Cupriavidus sp. USMAA1020: BKK80_25220Help
Entry
BKK80_25220       CDS       T04978                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cup  Cupriavidus sp. USMAA1020
Brite
Enzymes [BR:cup01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKK80_25220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AOZ09132
LinkDB All DBs
Position
2:1264106..1264738
Genome map
AA seq 210 aa AA seqDB search
MPVRARAAQPAPAFVLPPLPYAENALEPVISASTMGYHYGKHHRAYIDNLNRLAAGTGLA
GLPLEKIIAASADRADAVAIFNNAAQAWNHAFYWHSLRPGGGGAPPAALRPHIEAAFGSV
DACRKSLAAAAATGQFGSGWAWLVMDGGKLRVVKTTNADLPLTKGMQPLLTIDVWEHAYY
LDYQNRRADYVEAVIDKLLNWDFAAQNARL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccgcgcgcgcgccgctcagccggcgcccgccttcgtcctgccgccgcttccc
tatgccgagaatgcgctggaaccggtgatctcggccagcaccatgggctaccactacggc
aagcatcaccgcgcctatatcgacaacctgaaccggctggcggcgggcaccggactggct
ggcctgccgctggaaaagatcatcgcggcgagcgccgaccgcgccgatgcggtggcgatc
ttcaacaacgcggctcaggcctggaaccatgccttctactggcacagcctgcgcccgggc
ggcggcggcgccccgccggcggcgctgcggccgcacatcgaagccgccttcggctcggtc
gatgcttgcaggaagtcgctcgccgccgccgccgccaccggccagttcggcagcggctgg
gcctggctggtgatggacggcggcaagctgcgcgtggtcaagaccacgaacgccgacctg
ccgctcaccaagggcatgcagcccttgctgaccatcgacgtgtgggagcacgcctactac
ctcgactaccagaaccgccgcgcggactacgtcgaggccgtgatcgacaagctgctcaat
tgggacttcgccgcgcagaacgcgcggctgtga

DBGET integrated database retrieval system