KEGG   Cupriavidus sp. USMAA1020: BKK80_28095Help
Entry
BKK80_28095       CDS       T04978                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00010  Glycolysis / Gluconeogenesis
cup00620  Pyruvate metabolism
cup01100  Metabolic pathways
cup01110  Biosynthesis of secondary metabolites
cup01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cup00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BKK80_28095
   00620 Pyruvate metabolism
    BKK80_28095
Enzymes [BR:cup01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BKK80_28095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AOZ09594
LinkDB All DBs
Position
2:1938921..1940441
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLDIEFPYKDRYDNYIGGKWVPPRSGQYFDNISPVTGEVFCQIARSNADDVEL
ALDAAHAAKTAWGRTSPAERANVLNRIADRMEANLKRLAVAETIDNGKPLRETMAADLPL
AVDHFRYFAGTVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVLNVVSGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESVYDRFMERAIKRVEAIKQGHPLDPSTMIGAQASQEQLEKILSYIDLGK
QEGAQLLAGGARNQLGGALDKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDVNRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgccgaaatgaagttcctcgacatcgaattcccgtacaaggaccgctacgac
aactacatcggcggcaagtgggtgcccccgcgctcgggccagtacttcgacaacatctcg
ccggtgaccggcgaagtcttctgccagatcgcgcgctccaacgccgacgacgtggaactg
gcgctggacgccgcgcacgccgccaagaccgcctggggccgtacctcgccggccgagcgc
gccaatgtcctcaaccgcatcgccgaccgcatggaggccaacctcaagcgcctggccgtg
gccgagaccatcgacaacggcaagccgctgcgcgagaccatggcggccgacctgccgctc
gcggtcgaccacttccgctacttcgccggcaccgtgcgcgcccaggaaggcggcatctcc
gagatcgaccacgacaccatcgcctatcacttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctggccccggcgctggcc
gccggcaactgcgtggtgctcaagccggccgagcagaccccggcctcgatcctggtgctg
atggagatcatcggcgacctgctgccgccgggcgtgctcaacgtggtgagcggcttcggc
ctcgaggccggcaagccgctggcgtcgaacaagcgcatcgccaagatcgccttcaccggt
gagaccaccaccgggcggctgatcatgcagtacgcctcgcagaacctgatcccggtcacg
ctggagctgggcggcaagagccccaacatcttcttcgccgacgtgctcgacaaggacgac
gccttcttcgacaaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgccctgatccaggaatcggtctacgaccgcttcatggagcgc
gccatcaagcgcgtcgaggccatcaagcagggccacccgctcgacccctccaccatgatc
ggcgcgcaggcctcgcaggagcagctcgagaagatcctctcctacatcgacctgggcaag
caggaaggcgcgcagctgctggcgggcggcgcgcgcaaccagctcggcggcgcgctcgac
aagggctactacgtcaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtggtatcggtgaccaccttcaagaccgaagaggaagcgctg
gaaatcgccaacgacaccctgtacgggctgggcgccggcgtatggacgcgcgacgtcaac
cgcgcctaccgcttcggccgcgagatccaggccggccgcgtgtggaccaactgctaccac
gcctacccggcccacgcggccttcggcggctacaagcagtcgggcatcgggcgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctacagcccg
aacgcgctcggcttcttctga

DBGET integrated database retrieval system