KEGG   Cupriavidus sp. USMAA1020: BKK80_30305Help
Entry
BKK80_30305       CDS       T04978                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00500  Starch and sucrose metabolism
cup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKK80_30305
Enzymes [BR:cup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BKK80_30305
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BKK80_30305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459
Motif
Other DBs
NCBI-ProteinID: AOZ09965
LinkDB All DBs
Position
2:2448295..2451666
Genome map
AA seq 1123 aa AA seqDB search
MKRLSERAHSALLNADPLWYKDAVIYQLHIKSFFDGNGDGVGDFSGLLAKLDYLVDLGVD
TVWLLPFYPSPRLDDGYDIADYRNVHPEYGTLSEARRFIHAAHAHGIRVITELVINHTSD
QHPWFQRSRRAKPGSAAHNYYVWSDDDQAYAGTRIIFCDTEKSNWSWDPVAGAYFWHRFY
AHQPDLNFDNPHVLSEVLSVMRFWLDIGVDGLRLDAVPYLVEREGTSNENLPETHAIIRK
IRAHLDARYPGRMLLAEANMWPEDAQQYFGIDGAAADGRGEECHMAFHFPLMPRMYMAIA
REDRFPITDIMRQTPEVPVDCQWAIFLRNHDELTLEMVTSSERDYLWEVYASERRARINL
GIRRRLAPLMERDRRRIELMNSLLFSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWS
PDRNGGFSRADPERLVLPPLQGPLYGYEAVNVEAQERDPHSLLNWMRRMLALRRKHRAFG
RGTLRFLFPGNRKILAYLREYDDVHILCVANLSRAPQAVELDLSAFNGRVPVEMMGATPF
PAIGTLTYLLTLPPYGFYWFVLSDEAQPPPWHMETPEQMPDQVTLVLQNRGRPELTEASR
RLLDEEVLPPYLRRRRWFGAKGETIRRASLAYMLPFARGDGGEETWLGEVEVVLAGGRTE
RYQLPVGLLWDRDNPDGIPPLAHGLSMARVRQGSRVGLATDGFTSELFAREIVQALRAGS
ELRGPRETIRFKAEPGLAAMHPEREEIQWMSAEQSNSSLAYGNTAVLKLVRRLSGGCHPE
VEVTRYLTSQGYPHCAPLLGEAVRIGADGEPHTLMLLQGYIPNQGNGWDWTLDYLARAID
DALPAKESEDEFIEAMSGYAAMATTLGRRLAELHEVLARSSEDPAFAPEPAGAAESEQWA
RQALARLTHALDLLEICPIDTSQPAQERLGEDVQLLLQARQALPALVERLAAAAPGGLQT
RIHGDFHLGQVLIAQNDAYLVDFEGEPGQPLAWRRRKTSPLRDVAGLLRSLDYAAATVGT
DRQERTHAELPPALAQRRGELLERFRATATEAVLGGYREHLEACATPWVQAGQLQPLLDL
FLLERAAYEVEYEAANRVAWIDLPASGLARLVGQLLADDTEAR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctcagcgaacgtgcacatagcgccctgctgaacgccgacccgctttggtac
aaggacgccgtgatctaccagttgcacatcaagtccttcttcgatggcaatggcgacggc
gtgggcgatttctcgggcctgctggccaagctggactacctggtcgaccttggcgtcgac
accgtctggctgctgccgttctacccttcgccccgcctcgacgacggctacgacatcgcg
gactaccgcaatgtgcatccggagtacggcacgctgtccgaagcgcggcgcttcatccat
gccgcgcacgcgcatggcatccgcgtcatcaccgaactggtcatcaaccacacctccgac
cagcacccctggttccagcgctcgcgcagggccaaacccggctcggcggcccacaactac
tatgtgtggtccgacgacgaccaggcctacgccggcacgcgcatcatcttctgcgacacc
gagaagtccaactggagctgggacccggtggccggcgcctacttctggcaccgcttctat
gcgcaccagcccgacctgaacttcgacaatccgcacgtgctcagcgaggtgctgtccgtc
atgcgcttctggctcgacatcggcgtggacgggctgcggctggacgcggtgccctacctg
gtggaacgcgaaggcaccagcaacgagaacctgccggagacccacgccatcatccgcaag
atccgcgcccacctcgacgcgcgctatccgggccgcatgctgctggccgaagccaatatg
tggccggaagacgcgcagcagtacttcggcatcgacggcgcggccgcggacggcaggggc
gaggaatgccacatggccttccacttcccgctgatgccgcgcatgtacatggccatcgcg
cgcgaagaccgcttcccgatcaccgacatcatgcgccagaccccggaagtcccggtcgac
tgccagtgggccatcttcctgcgcaaccacgatgagctgacgctcgagatggtcaccagc
agcgagcgcgactacctgtgggaggtctacgcgtccgagcggcgcgcccgcatcaatctc
ggcatccgccggcggctggcgccgctgatggaacgcgaccgtcgccgcatcgagctgatg
aacagcctgctgttctccatgccgggcaccccggtcatctactacggtgacgagatcggc
atgggcgacaacatccacctgggcgaccgggacggcgtgcgcacgccgatgcagtggtcg
cccgaccgcaacggcggcttctcgcgcgccgacccggaacggctggtactgccgccgctg
caggggccgctgtacggctatgaagcggtcaacgtggaagcgcaggaacgcgacccgcat
tcgctgctgaactggatgcggcggatgctggcgctgcgccgcaagcaccgcgccttcggc
cggggcacgctgcgcttcctgttcccgggcaaccgcaagatcctggcctacctgcgtgag
tacgacgacgtgcacatcctgtgcgtggccaatctctcgcgcgccccgcaggcggtggag
ctggacctgtccgccttcaatggccgggttcccgtggagatgatgggcgccacgcccttc
cccgccatcggcacgctgacttacctgctcaccttgcctccctatggcttctactggttc
gtgctgagcgatgaggcacagccgccgccctggcacatggagactcccgaacagatgccc
gaccaggtcacgctcgtgctgcagaacagggggcgcccggagttgaccgaagcgtcccgg
cgcctgctcgacgaggaagtactgcccccctaccttcgccgccgccgctggttcggcgcg
aagggcgagaccatccgccgcgcatcgctggcctatatgctgcctttcgcgcgcggcgac
ggtggcgaggagacctggctcggtgaagtggaggtggtcctggccggcggccgcaccgag
cgctaccagcttcccgtgggcctgctgtgggaccgcgacaaccccgacgggataccgccg
ctcgcccacggcctgtcgatggcgcgcgtgcggcagggcagccgggtcgggctggccacc
gacggcttcacctcggaactgttcgcgcgcgagatcgtgcaggccctgcgtgccggcagc
gaactgcgcggcccgcgggaaaccatccgcttcaaggccgagcctggattggcggccatg
caccccgagcgggaagagatccagtggatgtcggccgagcaatccaacagctcgctcgcc
tacggcaacacggcggtgctgaagctggtccgccggctgtccggcgggtgccaccccgag
gtcgaagtgacacgctacctgaccagccagggctacccgcattgcgccccgctgctgggc
gaagcggtgcgcatcggcgccgatggcgagccacacacgctgatgctgctgcaaggctac
atccccaaccagggcaacggctgggactggaccctggactacctggcccgcgcgatcgac
gatgccttgccggcgaaggaaagcgaggacgagttcatcgaggccatgtccggctatgcc
gccatggccaccaccctgggccgcaggctggccgaactgcacgaggtgctggcacgctcc
agcgaggatcccgccttcgcccccgagcccgccggcgcggccgagagcgagcagtgggca
cggcaggccctggcccggctcacgcacgccctggacctgctggagatctgccccatcgat
acctcgcagcccgcgcaggagcggctcggcgaggatgtgcagttgctgctgcaggcacgc
caggccttgcccgcgctggtcgagcggctcgccgccgcggcgcccggcggcctgcagacc
cgtatccatggggattttcacctgggccaggtgctgatcgcgcagaacgacgcctacctg
gtggacttcgagggcgagcccggccagccgctggcctggcgccggcgcaagacctcgccg
ctgcgggatgtcgccggcctgctgcgctcgctcgactatgccgcagccaccgtcggcacc
gaccggcaggagcgcacccatgccgaactgccccccgcgctggcgcaacgccgcggagaa
ctgctggagcgcttccgcgccaccgccacggaggccgtcctcggcggctatcgcgagcac
ctcgaagcctgcgctacgccatgggtgcaggccgggcagctccagccgctgctggacctg
ttcctgctggaaagggccgcctacgaagtcgagtacgaggcggccaatcgcgtggcatgg
atcgacctgcccgccagcggcctggcaaggctggtgggccagctgctggcggacgacacg
gaggcccgatga

DBGET integrated database retrieval system