KEGG   Cupriavidus sp. USMAA1020: BKK80_30400Help
Entry
BKK80_30400       CDS       T04978                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cup  Cupriavidus sp. USMAA1020
Pathway
cup00550  Peptidoglycan biosynthesis
cup01100  Metabolic pathways
cup01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cup00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKK80_30400
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BKK80_30400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cup01003]
    BKK80_30400
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cup01011]
    BKK80_30400
Enzymes [BR:cup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BKK80_30400
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BKK80_30400
Glycosyltransferases [BR:cup01003]
 Polysaccharide
  Bacterial polysaccharide
   BKK80_30400
Peptidoglycan biosynthesis and degradation proteins [BR:cup01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BKK80_30400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AOZ09981
LinkDB All DBs
Position
2:complement(2478039..2480252)
Genome map
AA seq 737 aa AA seqDB search
MNSRYVSLLREHCARLLARIRPLLAAGSAAAGRAVSSALRRLRHPTRRGIVLALLAVPAL
FVAFVLALVPYTPGMGDIRKARIDRPALIVSADGRLLDQFKPVNREWVPLRRISPYMVDA
LVATEDRRFYEHHGIDWRRTASAALHTFSGDRQGGSSITQQLARNLYPDEIGRAPTLTRK
LKEAITAFKIESVYSKDQILETYLNTVPFLYNAYGVEMAARTYFGKSADRLDVLESATLV
GMLKANSTYNPVLNPERALQRRNTVLGQMDKYGKLKPGGYAWLVRQPLNVDFEPQSAPPG
VAPHFSAQLRKWLSAWAGRNGYNIYADGLVVRTTIDSRLQGMATQAMAWQTNQLQAIANE
AWDERTGCWPGNELFQAFMRQTAEYRAARDGGQTDQAALRRLAANPAFVRALCRSKTQVQ
AGFVAIDPRNGDIKAWVGSRDFREVPFDHVQQARRQPGSTFKPFLYGAAFADGARPSDTF
VDRDVAIPLSGHAVWRPADAEPPSGRPMTLRDALAYSRNRITAQLMQKERPEKVAQLARA
MGVRESSLEAVPSLALGTSPVTLKEMVSAYSTIANRGAYIEPRMVTRIENHDGQVLAEFP
SAVPERALPAGAAQVLVDVMRDVISRGTGNGIRSRFRIYADVAGKTGTTQDNADSWFILM
HPQLVAGAWVGFDDGRVTLGDYWGQGAHSALPMVGAFYDMALRARVIDAGARLGPESRPP
RVTHPRKQQRHFFFWPF
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagccgctatgtatcgttgcttcgagagcactgcgcccgcttgctcgcccgcatc
cggccgttgctcgccgccggcagcgcagcggccgggcgtgctgtcagcagcgcactgcgc
cgcctgcgtcacccgacgcggcgcggcatcgtgcttgcactccttgccgtgccagcgctg
ttcgtggcgttcgtgctggcgctcgtgccgtacacgccgggcatgggcgacatccgcaag
gcccgcatcgaccggccggcgttgattgtgtcggccgacggccggctgctcgaccagttc
aagccggtcaatcgcgagtgggtgccgctcaggcggatctcaccctatatggtcgacgcc
ttggtcgcgaccgaggaccgccgcttctacgagcaccatggcatcgactggaggcgtacc
gcgtcggcagcattgcatacgttctcgggcgaccggcagggcggctcatcgatcacccag
cagctggctcgcaacctgtatccggacgagatcggccgcgcgccgaccctcacgcgcaag
ctcaaggaagcgatcacggcgttcaagatcgaatccgtgtacagcaaggaccagatcctc
gagacctacctgaacacggtgccgttcctgtacaacgcctacggcgtggaaatggccgca
cgcacctacttcggcaaatccgccgatcggctcgacgttctcgaaagcgcgaccctggtc
ggcatgctgaaggccaacagcacctacaaccccgtgctgaatcccgagcgcgccttgcag
cggcgcaatacggtgctggggcagatggacaagtacggcaagctcaagcccggtggctac
gcatggctggtgcggcaaccactcaacgtcgatttcgagccgcagagcgcaccaccgggc
gtcgccccgcatttctcggcccaactgcgcaagtggttgagcgcatgggccgggcggaac
ggctacaacatctatgccgacggactggtggtgcgcaccaccatcgattcccgcctgcag
gggatggccacgcaggcgatggcctggcagaccaatcagttgcaagcgatcgccaacgag
gcgtgggatgagcggacgggatgctggccgggcaatgagctgttccaggccttcatgcgg
cagacggcggagtaccgcgccgcgcgcgacggggggcagacggaccaggccgcgctgagg
aggctcgcggcgaatcctgcattcgtccgcgcgctgtgccggagcaagacgcaggtccag
gcgggcttcgtcgcgatcgatccgcgcaacggcgacatcaaggcctgggtcggcagccgc
gatttccgcgaagtgccgttcgatcatgtgcaacaggcccggcgccagcccggttcgacc
ttcaagcccttcctctacggcgcggccttcgcggatggcgcacggccgagcgataccttc
gtcgaccgggatgtcgccattccattgagcgggcatgcggtctggcggccggccgacgcg
gaaccgcccagcggccggccgatgacgctgcgtgacgcgctggcttactcgcgcaatcgc
atcaccgcccagctcatgcagaaggagcgccccgagaaggtcgcgcagctcgcgcgcgcg
atgggcgtgcgcgagagttcgctcgaagccgtaccgtcgctcgcgctcggcacgagcccg
gtcacgctgaaggaaatggtctcggcgtacagcaccatcgcgaaccgcggcgcctatatt
gaaccgcgcatggtcacgcgcatcgagaatcatgacggccaggtgctcgccgaattcccg
agcgccgtgcccgaacgggcgctgcctgccggtgcggcccaggtgctcgtcgacgtcatg
cgcgacgtgatcagccgtggcacgggcaacggcatccggtcgcgcttccggatctacgcg
gatgtggccggcaagaccggcacgacgcaggacaatgcggatagctggttcatcctgatg
catccgcaactggtcgcgggcgcctgggtgggattcgacgatggacgcgtgacgctcggc
gactactgggggcagggcgcgcacagcgccctgccgatggttggcgccttctacgacatg
gcgctgcgcgcgcgggtgatcgacgcgggcgcgcggctcgggccggagtctcggccgccg
cgcgtgacccatccgcgcaagcagcagcggcacttcttcttctggccgttctga

DBGET integrated database retrieval system