KEGG   Corynebacterium ulcerans 210931: Cul210931_0290Help
Entry
Cul210931_0290    CDS       T03414                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cuq  Corynebacterium ulcerans 210931
Pathway
cuq00020  Citrate cycle (TCA cycle)
cuq00190  Oxidative phosphorylation
cuq00650  Butanoate metabolism
cuq01100  Metabolic pathways
cuq01110  Biosynthesis of secondary metabolites
cuq01120  Microbial metabolism in diverse environments
cuq01130  Biosynthesis of antibiotics
cuq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cul210931_0290 (sdhA)
   00650 Butanoate metabolism
    Cul210931_0290 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cul210931_0290 (sdhA)
Enzymes [BR:cuq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cul210931_0290 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Cul210931_0290 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIU29655
UniProt: A0A0M4LJV9
LinkDB All DBs
Position
310673..312688
Genome map
AA seq 671 aa AA seqDB search
MSINSETATRPEFTQPASIVDGVKLGSILESNEPKGVPTKDMWEYQKDHMNLVSPLNRRK
FTVLVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGA
YRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSGAAALQRQIGLGTVEIFTHADMHDLIITEENGKKTCRGIVTRNL
ITGELTPHTGHAVILATGGYGNVYHMSTLAKNSNASAMMRAYDLGAYLASPSFIQFHPTG
LPVNSEWQSKTILMSESLRNDGRIWSPIEPKDDRDPNTIPEEERDYFLERRYPAFGNLVP
RDVASRAISQQINKGLGVGPLHNSAYLDFRDAIERLGENTIRERYSNLFQMYEEAIGENP
FKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECSWTYHGANRLGANSLLSASVDGW
FTLPFTIPNYLANHLGEAKLPEDAPEAVAAVARAQARIDKLMNIKGDDPHGPEYYHRQLG
DILYFSCGVARNIEDLKAGIENIRKLRKEFWANLRITGEAEEMNQVLEYACRVADYIDLG
ELMCVDALDRDESCGAHFRDDHLSPEGEAERDDDNWCFVSAWEPGAHENEFIRHAEPLTF
ESIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaactctgaaaccgctactcgccctgagttcacccagccagcctccatcgtc
gatggcgtgaaactgggcagcatccttgagtccaatgagcccaagggtgttcctaccaag
gacatgtgggagtaccagaaagaccacatgaacctggtctcccccctgaaccgtcgtaag
ttcacggttcttgttgtgggaactggcctttccggtggtggcgctgctgctgccctcggc
gagctgggatacaacgttaaagtcttcacttaccacgatgctcctcgtcgtgcgcactct
attgctgcccagggtggcgtgaactccgcccgtggcaagaaagtggataacgacggcgct
taccgccacgtgaaagacaccgtgaagggcggcgactaccgttgtcgcgaatctgattgt
tggcgcctggcgtacgaatccgtacgcgtcatcgatcacatgaatgccatcggtgcacct
ttcgcccgtgagtatggcggaaccctagctacccgttccttcggtggtgtgcaggtttcc
cgtacgtactacacgcgtggtcaaacaggccagcagcttcagctatctggcgcagctgcg
ctgcagcgtcagattggtcttggaaccgtagagatcttcacgcatgcagacatgcatgac
ttgatcatcaccgaggaaaacggcaagaaaacttgccgcggtatcgtcactcgtaacctg
atcactggtgagctcacacctcacacaggccacgcagtcatcttggctactggcggttac
ggcaacgtttatcacatgtctacgctggctaagaactccaatgcatcggcaatgatgcgt
gcgtacgacctcggcgcttatcttgcttctccgtcgttcatccagttccacccgaccgga
cttccggtcaactcggagtggcagtcgaagacgatcctgatgtctgagtctttgcgtaac
gacggccgcatctggtccccaatcgagcccaaagacgatcgcgaccccaacacgatcccc
gaagaagagcgcgattacttcctggagcgccgttacccggcattcggtaacctcgtgcct
cgcgacgtggcatcgcgtgctatttctcagcagatcaacaagggactcggcgttgggcct
ctgcacaactccgcatacctggacttccgtgatgcaattgagcgtctgggtgagaacacg
atccgtgagcgctactccaacctcttccagatgtatgaagaggcaatcggcgagaacccg
ttcaaggctccgatgcgtattgcaccgacctgccacttcaccatgggcggtctgtggacg
gacttcaacgagatgacctccatcgacggtctctttgccgccggtgagtgctcctggact
taccacggtgcaaaccgtctgggtgctaactccttgctttctgcttctgttgatggctgg
ttcaccttgccatttaccattccgaactacttggctaaccaccttggagaagccaagctg
cctgaggacgctcctgaagcagtagcagcagtcgcccgagctcaggctcgtattgacaag
ctcatgaacatcaagggtgatgaccctcatggccctgagtactaccaccgccagctaggc
gatatcctctacttctcttgtggcgttgcccgcaacatcgaagacctgaaggccggcatt
gagaatatccggaagctccgtaaggaattctgggcgaacctccgcattaccggcgaggca
gaggaaatgaaccaggttcttgagtacgcatgtcgcgtagcagactacatcgacctcggc
gagctcatgtgcgttgatgcacttgaccgcgacgagtcctgtggtgcgcacttccgtgac
gatcacctttctcctgaaggtgaagcggagcgtgacgacgataactggtgcttcgtttct
gcatgggagccaggcgcgcatgaaaacgagttcattcgccatgctgagccactcacgttc
gaatcgatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system