KEGG   Corynebacterium ulcerans 210931: Cul210931_0291Help
Entry
Cul210931_0291    CDS       T03414                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cuq  Corynebacterium ulcerans 210931
Pathway
cuq00020  Citrate cycle (TCA cycle)
cuq00190  Oxidative phosphorylation
cuq00650  Butanoate metabolism
cuq01100  Metabolic pathways
cuq01110  Biosynthesis of secondary metabolites
cuq01120  Microbial metabolism in diverse environments
cuq01130  Biosynthesis of antibiotics
cuq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cuq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cul210931_0291 (sdhB)
   00650 Butanoate metabolism
    Cul210931_0291 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Cul210931_0291 (sdhB)
Enzymes [BR:cuq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Cul210931_0291 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Cul210931_0291 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_4 Fer4_2 Fer4_6 Fer4_15 Fer4_21 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AIU29656
UniProt: A0A0E3N111
LinkDB All DBs
Position
312688..313437
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPNSEGHFESIDVEDAVAQMSILELLDHVNTGLVEEGKEPFVFASDCRE
GICGTCGLLVNGRPHGLDKNKPSCQQRLDHVADGSTLKIEPFRSAAYPVIKDLAVDRSAL
DRVMQKGGYVSINAGTAPDADTIYQNHEKAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLALMPLGREERGKRARNMIDELETNFGHCSLYGECADVCPAGIPLSAVAAINKERA
RAFFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccatcttgaaatttggcgtcaggccggtcctaacagcgaaggtcatttcgag
tccatcgacgtcgaagacgccgtagcacagatgtcgatccttgagcttctggaccacgtc
aatacaggcttggttgaagaaggcaaagagcctttcgtcttcgcctctgactgccgtgaa
ggcatctgtggcacctgtggcctgctggttaacggccgaccacatggcttggacaagaac
aagccttcctgccagcagcgcctcgatcacgtggcagacggctcgaccctaaagattgag
cctttccgttctgctgcttaccctgtgatcaaggaccttgcggttgatcgctcggctctt
gaccgcgtgatgcaaaagggcggctacgtttccatcaacgcaggcacggctcctgatgcg
gacactatttaccagaaccatgagaaggctgagcttgctcttgaccatgctgcatgcatt
ggttgtggtgcctgcgtggctgcctgccccaacggcgcagcacacctgttcaccggagca
aagcttgttcaccttgctcttatgcctttgggtcgtgaagaacgcggcaagcgtgcccgc
aatatgattgatgagcttgaaaccaactttggtcactgctcgttgtacggcgagtgcgct
gatgtctgcccggcaggtattccgctgtccgctgttgcggctattaacaaggagcgtgcc
cgcgctttcttccgcggtaaggacgactaa

DBGET integrated database retrieval system