KEGG   Corynebacterium ulcerans 210931: Cul210931_0391Help
Entry
Cul210931_0391    CDS       T03414                                 

Gene name
tuf
Definition
(GenBank) Elongation factor
  KO
K02358  elongation factor Tu
Organism
cuq  Corynebacterium ulcerans 210931
Brite
Translation factors [BR:cuq03012]
 Eukaryotic Type
  Elongation factors
   Cul210931_0391 (tuf)
 Prokaryotic Type
   Cul210931_0391 (tuf)
Mitochondrial biogenesis [BR:cuq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Cul210931_0391 (tuf)
Exosome [BR:cuq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Cul210931_0391 (tuf)
  Exosomal proteins of breast cancer cells
   Cul210931_0391 (tuf)
  Exosomal proteins of colorectal cancer cells
   Cul210931_0391 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIU29752
UniProt: A0A0E3N5D6
LinkDB All DBs
Position
420465..421655
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPDLNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEEWTKSILELMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGQLNV
NEDVEIIGIKEKSTQTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtactaagccgcacgttaacatcggtaccatcggtcac
gtcgatcacggcaagaccaccactaccgctgctatcaccaaggttctggctgacgcatac
ccggatctcaacgaggctttcgccttcgacgccattgataaggcaccggaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgtggatgctccgggtcacgccgactacatcaagaacatgatcaccggcgctgctcag
atggacggcgcaatcctcgtggttgctgctaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggttggcgtcccttacatccttgttgctcttaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gcagagcaggattacgatgaagaggctccaatcatccacatctccgctctgaaggctctc
gagggcgacgaggagtggaccaagtccatcctcgagctcatgcaggcttgcgacgattcc
atcccggatccagagcgcgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggccgtgttgagcgtggccagctgaacgtc
aacgaagacgttgagatcatcggtatcaaggaaaagtccacccagaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacactgaggctggcgacaactgtggtctcctc
ctccgtggtatcaagcgcgaagacgtcgagcgcggtcaggttgttgttaagccaggcgct
tacactcctcacaccgagttcgagggctctgtctacgtcctttccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtcctcagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggttatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system