KEGG   Corynebacterium ulcerans 210931: Cul210931_1169Help
Entry
Cul210931_1169    CDS       T03414                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase (PEPC) (PEPCase)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cuq  Corynebacterium ulcerans 210931
Pathway
cuq00620  Pyruvate metabolism
cuq00680  Methane metabolism
cuq01100  Metabolic pathways
cuq01120  Microbial metabolism in diverse environments
cuq01200  Carbon metabolism
Module
cuq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cuq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cul210931_1169 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    Cul210931_1169 (ppc)
Enzymes [BR:cuq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cul210931_1169 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIU30512
LinkDB All DBs
Position
complement(1287958..1290777)
Genome map
AA seq 939 aa AA seqDB search
MPVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGTAAFDRVEAARQLAFKISRKEAQVE
DLVSLLKDISAADAISIIRAFSHFALLANMVEDLHDELGRLRRQETGEEDPDSTLGATWK
KLAKAGVTSEDVSGLLGNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKERHAILSADPN
ALTATRLEENTRRIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYKLSLLTAIPEINKQV
ADHIQREYGVSSEDALRSLFIKPGSWIGGDHDGNPYVTAETLHYATTRAAETVLKFYARE
LHQLEHELSLSDRLTDVSPTLRVLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
TEAVEGSWYARHDAYSDPDELAADLDVIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFEQAHVTKHYRELDENEKIRVLTAELSSPRPLIPRDGASYSE
VTQRELDIIAEAKRAVDAFGAMMIPHSIISMAESASDILEPMVLLKEFGLIRIQEGQLTG
HIDVIPLFETIDDLQNGAKILQDLWRIPLYRSYVEQRNNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVSMCKQHGVALRLFHGRGGTVGRGGGPSYDAILAQPHGAVQGSVRVTEQG
EIISAKYGSVGAARRNLEALASATLEASLLTIDQVEEQYPEAYEIMGEISRLSQRKYSRL
AHEDPGFIEYFTSSTPLEEIGDLNIGSRPSSRKQTQSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALHEWIEKGCVRTAELSADERLAILQKLNDSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFADISAEFDLTKTMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYREGDTDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaagctacgtctgcaggtccactatccgaacagcttgttgaggatatacgc
tttctaggtgcacttttgggggaggtgatcaaagaacaagagggaacggcagcctttgac
cgagtcgaagcagcgcgacagctggcttttaaaatctcgcgcaaagaggcacaggttgaa
gacttagtatcactgctcaaagatatttcagcagcagatgcgatatcgattattagagcg
tttagccattttgcgttgctagcaaacatggtggaggacttgcacgatgaactgggtaga
ctccggcgacaagaaaccggtgaagaagacccagattcaactttgggtgcgacctggaaa
aagcttgctaaggctggagtaacgagcgaagacgtgtccggtttactcggtaactttcaa
gttgccccggtgcttaccgctcaccctacggaaacccgtagacgtacgatttttgatgcg
caagagcatatgactactttgctcaaagaacgtcatgcgattctgagcgcagatccgaat
gcgctgacggctacgcgtcttgaagagaatactcgtcggattcgccggtggttgactctc
atctggcagaccgcgcttatccgggtggcccgccctaggattgaggacgaggtagaagtt
ggattgcgatactataagctctccttgcttactgcgatccctgagatcaacaagcaagtg
gctgatcatatccagcgagaatatggtgttagctctgaagatgctttgcggtcgctattc
attaaacctggaagctggatcggtggcgaccatgacggtaacccgtatgtcactgcggaa
actctgcactatgcgacgacacgagcagccgagactgtattaaagttttatgcacgcgaa
ctgcatcaacttgaacatgagttatcgctgtcggataggttgactgatgtgagcccgact
ctgcgcgtgcttgctgatttaggacataacgacgtcccatcgcgggtcgacgagccttat
cgccgtgccgtccacggtgtgcgcggtagagtacttgctacgctagcttctcggattggt
acagaagcggtagaaggctcgtggtatgcccgtcatgatgcttattctgatccagatgag
cttgcagcagatttggatgtcattgatgcttccttgcggagaacgcacgatgaactcatc
gcagatgatcgcttgttgcgcatcaggacagcggtatcaagctttggtttccatctctat
tcgatggatttgcgccaaaattctgagagctatgaggatgtgcttaccgagctctttgag
caagcccacgtaaccaagcactatcgcgaattggacgagaacgaaaagattcgcgtttta
actgctgaactatcgtcaccgagaccccttataccgcgcgatggtgcgtcatatagtgag
gtaacccagcgtgagctcgacattattgctgaggcaaagcgtgcagtagatgcttttggt
gcaatgatgatcccacattcgattatctcgatggcagaatctgcgagcgatatcctcgaa
ccgatggtcctcctgaaagaattcggattaatccgcattcaggaaggacaacttaccgga
cacattgacgtcataccgctttttgaaacgatcgatgatctgcaaaatggtgccaagatt
ctccaagatctatggcggataccgttgtatcgcagttatgtggagcaacgaaataatctt
caagaggtcatgcttggctattccgattccaataaagatggtggctatctcgccgcaaac
tgggctctgtatgctgccgaaactgatttagtaagcatgtgtaaacaacatggtgtagcg
ctgaggcttttccatggccgcggtggaaccgtaggacgcggcggcggcccctcttatgac
gctatccttgctcagccacatggtgctgtgcaaggcagtgtacgtgttacagaacaaggt
gagatcatctcagcaaaatatggttctgtgggtgcggctcgtcgtaacctagaagccttg
gcttcagccacgctggaggcgtcgctgcttacaatcgatcaggtagaagagcaatatcct
gaggcgtatgagattatgggtgaaatctcacgcttgagtcagcgaaagtattcgaggctt
gcgcatgaagaccctggatttattgagtacttcacatcctccacacctttggaagagata
ggcgaccttaacatcggctcgcgtccttcgtcgcgaaaacaaacccaaagtatcgacgat
ttacgcgcaattccatgggtactcagctggtcccagtcccgtgttatgctgcccggctgg
tatggagtaggcagcgctttgcatgaatggatagaaaaaggctgtgtgcgcacagcggaa
ctctcagcagatgagcgccttgctattttgcagaagcttaatgattcttggccgttcttt
tcttctgtgctgtctaatatggcgcaggtgatgagcaaagctgagatgcaacttgcgaag
ctctattcgggattggtagcagatcaggaagctgcaaacagaatatttgctgatatttct
gccgaattcgatctcactaagacgatgttcctcaagatcaccggcttctcggggcttctc
gacgacaacccgatgcttgcacggtcagttcgctcgcgttacccgtatctgttgccgctt
aatacactgcaactcgaaatgctacgtaggtatcgcgaaggtgatactgatccgaaggtg
gtgcatggcattcgcctagctatgaacggcttggctaccgcgctgcgaaattctggctag

DBGET integrated database retrieval system