KEGG   Corynebacterium ulcerans 210931: Cul210931_2043Help
Entry
Cul210931_2043    CDS       T03414                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cuq  Corynebacterium ulcerans 210931
Pathway
cuq00010  Glycolysis / Gluconeogenesis
cuq00071  Fatty acid degradation
cuq00350  Tyrosine metabolism
cuq00625  Chloroalkane and chloroalkene degradation
cuq00626  Naphthalene degradation
cuq01100  Metabolic pathways
cuq01110  Biosynthesis of secondary metabolites
cuq01120  Microbial metabolism in diverse environments
cuq01130  Biosynthesis of antibiotics
cuq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cuq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cul210931_2043 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cul210931_2043 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Cul210931_2043 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cul210931_2043 (adhA)
   00626 Naphthalene degradation
    Cul210931_2043 (adhA)
Enzymes [BR:cuq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cul210931_2043 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11 TRAM
Motif
Other DBs
NCBI-ProteinID: AIU31357
LinkDB All DBs
Position
complement(2210013..2211164)
Genome map
AA seq 383 aa AA seqDB search
MSPAGVMSVGVQSFRGLNEYSSQQGVGIENAYEKGKIDVKNDFPEAFTAAVVDDFGPELT
IHDVDLPEPGPNQALVKLVASGICHTDLHAAEGDWPVKPEPPFVPGHEGVGEVVKLGPGH
HGVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYGGYTVDGSFGEYMLVDTRYCARI
PEGSDPIEVAPILCAGVTVYKGLKETECKPGQYMVISGIGGLGHIAVQYAVAMGMRVIAV
DIADEKLELARKHGAEFAVNALKEDPVEAINAFTKGGAHGVLVTAVHPQAFGQAIGMTRK
GGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQDLEEALDFYARGMIKPTVTECKL
DDVNSVFADMHQGKVDGRMAIRY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgtccccagccggcgttatgtcggttggggttcagtcatttaggggacttaatgaatat
agttcccaacaaggtgtgggtattgaaaatgcctacgagaaaggaaagatcgacgtgaaa
aacgatttccctgaggccttcaccgctgctgtagttgacgactttggccctgaactcact
attcatgatgtagatttgcctgagccgggacccaaccaggcgctggtgaaactagtagct
tccggcatttgccatacagaccttcacgcagcggaaggcgactggccagtgaaaccggaa
ccaccgtttgtccctgggcatgaaggcgtgggcgaagtcgttaaattagggcctggccat
cacggagtgcagctcggagatatggtgggcaacgtatggctatggtctgcgtgtggggag
tgcgagtattgccgcaccggccgcgaaactctttgcaatgacgcggaatatggtggctac
acggttgatggctccttcggtgaatacatgctggtagatacccgttactgtgctcgtatt
ccagagggatctgaccccatcgaggttgcaccgatcttgtgtgctggtgtgactgtatat
aagggcctcaaagaaactgagtgcaagccgggccagtacatggtcatttctggtatcggc
ggtctgggccatatcgctgtgcaatatgcggtagctatgggtatgcgcgtaattgcagtg
gatatcgcggacgaaaaattagagcttgcgcggaaacatggtgctgaatttgcagtaaat
gcgttgaaggaagacccggttgaagcgatcaatgcttttactaagggtggtgcgcatggc
gttctggtcaccgccgttcacccgcaagcgttcggtcaagccattggtatgactcgaaaa
ggtggaacgatcgtattcaatggtcttcctccaggagagttccctgcacctatctttgag
attgtgttcaaggggctaaccattcgcggatcgctggtgggaacacgccaggatctggaa
gaagctctcgatttctatgcgcgcggcatgattaagcctactgttacggaatgcaagctt
gacgacgtcaacagtgtctttgccgatatgcatcagggcaaagtcgatgggcgcatggcg
attaggtactaa

DBGET integrated database retrieval system