KEGG   Corynebacterium urealyticum DSM 7109: cu0055Help
Entry
cu0055            CDS       T00685                                 

Definition
(GenBank) serine/threonine protein kinase PknA
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Brite
KEGG Orthology (KO) [BR:cur00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cur01001]
    cu0055
Enzymes [BR:cur01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     cu0055
Protein kinases [BR:cur01001]
 Serine/threonine kinases: Other
  Bacterial family
   cu0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo SpoIIIAH Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CAQ04015
UniProt: B1VE26
LinkDB All DBs
Position
complement(61031..62674)
Genome map
AA seq 547 aa AA seqDB search
MTEHPEQNQPDRTDIEYTQRLLGERYQLSWIVGRGGMSTVWLARDTVAQRDVAIKILKPE
YTESPEFRERFRNEAEAAEHFDSPNVVATYDYGEISADGSQPTNETRAVFCYIVMEYVRG
ESLADVLRRERQLPEPLALDLIRQTAMGLAAIHATGTVHRDIKPANLLLTADGTVKITDF
GIAKAAQAVPLTQTGMVVGTAQYVSPEQAQGREVTAASDVYSLGVVAYEVLAGHRPFRGD
SSVSVAIKHISEQPEPLPEELSAPLRELVNTCLRKSPRARYADGQELAEATAAVLSGAPA
PRPAALSAADAAAHTDVFAAHGGARGAAPEDSDAELSQVVSGPGTAVPPRQGPAQGPRKA
SAAGAAGAASSRSAGRRGGQRGSATPWIVLGVVVALGLGVIGYLLLSDSNSSTQEQETKT
VTSEVTTSPTQEEYVPQQPVDPRPEKTQPSEDNGSDDGETSSTRPERPTQSSTRPGRPTR
TQPTPSSSRPPSQPSQPTAPTEDDPVPPAPDPGGEQPNPGTNAEGPTGTGTSNPADGKVG
ALGLRAI
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcacccagagcagaaccagccggaccgcacggatatcgagtacacccagcgg
ctattgggtgagcgctaccagctgagctggatcgtcggccgaggcgggatgtccacggtg
tggctcgcccgcgacaccgtggcgcagcgggacgtggccatcaagatcctgaaacccgaa
tacacggagagcccggagttccgcgagcgcttccgcaacgaggcggaggccgcggagcac
ttcgattccccgaatgtggtcgccacctatgactacggggagatttccgcggacggctcc
cagcccacgaacgagacccgtgcggtgttctgctacatcgtgatggagtacgtgcgcggc
gagagcctggcggatgtgctgcgccgcgagcgccagctgccggagcccctggccttggac
ctgatccggcagaccgcgatgggcctggcggcgatccacgccaccggtacggtgcaccgg
gatatcaagcccgccaacctgctgctcaccgccgatggcacggtgaagatcacggacttc
ggtatcgcgaaggccgcgcaggccgtgccgctgacccagaccggcatggtggtgggcacg
gcccagtacgtctcccccgagcaggcgcagggccgggaggtcaccgccgcttccgatgtc
tactccctcggcgtggtggcctacgaggtgctggctggccaccggccattccgcggggac
tcctccgtctcggtggcgatcaagcatatttccgaacagccggagcccctgcccgaggag
ctcagcgccccgctgcgcgagctggtgaacacctgcctgcgcaagagcccgcgtgcccgc
tacgccgatggccaggagctcgcggaggccaccgccgctgtcctttccggggctccggcc
cctcgcccggcggccctgtccgctgccgacgccgccgcccatacggacgtcttcgctgct
cacggtggtgcccggggtgctgctcctgaggattccgacgcggagctcagccaggtcgtg
tcgggcccgggtacggctgtcccgccgcggcagggtcccgcccaagggccgcgcaaggcc
agcgccgcgggtgctgcgggggcggcgtcctcccgctcggcgggtcgtcgcggcgggcag
cgcggctctgcgaccccgtggatcgtgctcggggtggttgtagccctcggcctgggtgtg
atcggctacctcctgctcagcgattcgaactcctcgacccaggagcaggagacgaagacc
gtgaccagcgaggtcacgacctcccccacccaggaggagtacgtcccgcagcagccggtg
gatccccgcccggagaagacccagccgagcgaggacaatgggtcagatgacggggagacc
agctcgacccgaccggaacgtcccacgcagtcgtcgacacggccgggtaggccgacgagg
acgcagcccacgccgagctcctcacgcccgccctcgcagccgtcccagccaacggccccg
acggaggacgaccccgtcccgccggctccggacccgggcggcgagcagcccaacccgggg
actaacgcggagggcccaaccggcacgggtacctccaaccccgccgatggcaaggtcggg
gcgctggggctgcgggcgatctag

DBGET integrated database retrieval system