KEGG   Corynebacterium urealyticum DSM 7109: cu0310Help
Entry
cu0310            CDS       T00685                                 

Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
cur  Corynebacterium urealyticum DSM 7109
Brite
KEGG Orthology (KO) [BR:cur00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cur03012]
    cu0310
   03029 Mitochondrial biogenesis [BR:cur03029]
    cu0310
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cur04147]
    cu0310
Translation factors [BR:cur03012]
 Eukaryotic Type
  Elongation factors
   cu0310
 Prokaryotic Type
   cu0310
Mitochondrial biogenesis [BR:cur03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    cu0310
Exosome [BR:cur04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   cu0310
  Exosomal proteins of breast cancer cells
   cu0310
  Exosomal proteins of colorectal cancer cells
   cu0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAQ04270
UniProt: B1VET1
LinkDB All DBs
Position
387862..389052
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLHDTYPEQNKAFAYDAIDKAPEEKE
RGITINISHVEYETEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEELLELVEMEVRELLAEQDYDEEAPVVPISALGAL
DGDQKWVDSILELMKACDESIPDPERETDKPFLMPVEDIFTITGRGTVVTGRVERGVLNL
NDEVEILGIREKSTKTTVTSIEMFNKLLDTAEAGDNAALLLRGLKREDVERGQIIAKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVTLPEGTDMVMPGDNVE
MSVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKINK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcaaagttcgagcgcacaaagccgcacgtaaacatcggtaccatcggtcac
gttgaccacggtaagaccaccacgactgctgcgatcaccaaggttctgcacgacacctac
ccagagcagaacaaggccttcgcctacgacgccatcgacaaggcgccggaggagaaggag
cgcggcatcacgattaacatttctcacgtcgagtacgagactgagaagcgtcactacgca
cacgtcgatgccccgggccacgctgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgccatcctggttgttgctgcaaccgatggcccgatgccgcagacccgtgag
cacgttctgctggctcgccaggttggcgttccgtacatcctcgttgcactgaacaagtgc
gacatggttgacgatgaggagctcctcgagctcgtcgagatggaggtccgcgagcttctg
gctgagcaggactacgacgaggaggctccggtcgtcccgatctccgcactgggcgccctg
gacggcgatcagaagtgggtcgactccatcctcgagctcatgaaggcttgcgacgagtcc
atcccggacccggagcgcgagaccgacaagccgttcctgatgccggttgaggacatcttc
accattaccggtcgcggcaccgtcgttaccggccgtgttgagcgtggcgtcctgaacctg
aacgacgaggtcgagatcctgggcatccgcgagaagtccaccaagaccaccgtcacctcc
atcgagatgttcaacaagctgctggacaccgcagaggctggcgacaacgctgcactgctg
ctgcgtggtctgaagcgtgaggacgtcgagcgaggccagatcatcgctaagccgggcgct
tacaccccgcacaccgagttcgagggctccgtctacgtcctgtccaaggacgagggcggc
cgtcacaccccgttcttcgacaactaccgtccgcagttctacttccgtaccaccgacgtc
accggtgtcgttaccctgccagagggcaccgacatggtcatgccgggcgacaacgttgag
atgagcgtcaagctgatccagccggtcgcaatggacgagggcctgcgcttcgctatccgt
gagggtggccgcaccgttggtgctggtcgtgtgaccaagatcaacaagtaa

DBGET integrated database retrieval system