KEGG   Corynebacterium urealyticum DSM 7109: cu1829Help
Entry
cu1829            CDS       T00685                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cur  Corynebacterium urealyticum DSM 7109
Pathway
cur00010  Glycolysis / Gluconeogenesis
cur00071  Fatty acid degradation
cur00350  Tyrosine metabolism
cur00625  Chloroalkane and chloroalkene degradation
cur00626  Naphthalene degradation
cur01100  Metabolic pathways
cur01110  Biosynthesis of secondary metabolites
cur01120  Microbial metabolism in diverse environments
cur01130  Biosynthesis of antibiotics
cur01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cu1829 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    cu1829 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    cu1829 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cu1829 (adhA)
   00626 Naphthalene degradation
    cu1829 (adhA)
Enzymes [BR:cur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cu1829 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Methyltransf_25 adh_short TrkA_N Methyltransf_11 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: CAQ05788
UniProt: B1VHY8
LinkDB All DBs
Position
2123289..2124317
Genome map
AA seq 342 aa AA seqDB search
MTDTTFRAAVVEDFGPELNLRDVEMPTPGRNQALVKLQASGICHTDLHAAEGDWPVKPEP
PFVPGHEGVGEVVELGPGDHSVKVGDIVGNVWLWSACGECEYCRTGWETLCNQAEYGGYT
VNGSFGTYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKVSETKPGQFMVISGVGG
LGHIAVQYAVAMGMRVIAVDIADEKLELAKKHGAEFTVNAKHADPAEAVQEFTDGGAHGV
LVTAVHPQAFGQAVGMARKGGTIVFNGLPPGDFPAPIFEIVFKALTIRGSLVGTRQDLAE
ALDFYARGLIKPTVSECSLDDVNAVFEELRHGKVDGRMSIRY
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacaacgttccgcgccgccgtcgttgaggacttcggtcccgaactcaacctc
cgcgacgtcgagatgcccacgcccggccgcaaccaggcgctggtgaagctgcaggcctcc
ggcatctgccacaccgacctccatgccgccgagggtgactggcccgtcaagcccgagccg
cccttcgttcccggccacgagggtgtcggcgaggtcgtcgaactcggccccggtgaccac
tccgtcaaggtcggcgacatcgtcggcaacgtctggctctggtccgcctgcggtgagtgc
gagtactgccgcaccggatgggagaccctgtgcaaccaggccgagtacggcggctacacc
gtcaacggctccttcggcacctacatgctcgtggatacccgctactgcgcccgcatcccc
gagggctccgaccccgtcgaggtcgccccgatcctgtgcgccggcgtcaccgtctacaag
gggctgaaggtctccgagaccaagcccggtcagttcatggtcatctccggcgtcggcggc
ctcggccacatcgccgtccagtacgccgtggccatgggtatgcgcgtcatcgccgtcgac
atcgccgacgagaagctcgagctggccaagaagcacggcgcggagttcaccgtcaacgcc
aagcacgccgacccggccgaggcggtccaggagttcaccgacggcggcgcccacggtgtc
ctggtcaccgcggtccacccgcaggcgttcggccaggcggtcggcatggcccgcaagggc
ggcaccatcgtgttcaacggcctgcccccgggggacttcccggccccgatcttcgagatc
gtgttcaaggccctgaccatccgcggctccctcgtgggtacccgccaggacctggccgag
gcgctcgacttctacgcccgcggcctgatcaagccgaccgtgtccgagtgctccctcgac
gacgtcaacgccgtcttcgaggaactgcgccacggcaaggtcgacggccgcatgtccatc
cgctactag

DBGET integrated database retrieval system