KEGG   Corynebacterium ulcerans FRC11: CulFRC11_0285Help
Entry
CulFRC11_0285     CDS       T03408                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cus  Corynebacterium ulcerans FRC11
Pathway
cus00020  Citrate cycle (TCA cycle)
cus00190  Oxidative phosphorylation
cus00650  Butanoate metabolism
cus01100  Metabolic pathways
cus01110  Biosynthesis of secondary metabolites
cus01120  Microbial metabolism in diverse environments
cus01130  Biosynthesis of antibiotics
cus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CulFRC11_0285 (sdhA)
   00650 Butanoate metabolism
    CulFRC11_0285 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CulFRC11_0285 (sdhA)
Enzymes [BR:cus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CulFRC11_0285 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CulFRC11_0285 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AIU31882
LinkDB All DBs
Position
304737..306752
Genome map
AA seq 671 aa AA seqDB search
MSINSETATRPEFTQPASIVDGVKLGSILESNEPKGVPTKDMWEYQKDHMNLVSPLNRRK
FTVLVVGTGLSGGGAAAALGELGYNVKVFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGA
YRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLSGAAALQRQIGLGTVEIFTHADMHDLIITEENGKKTCRGIVTRNL
ITGELTPHTGHAVILATGGYGNVYHMSTLAKNSNASAMMRAYDLGAYLASPSFIQFHPTG
LPVNSEWQSKTILMSESLRNDGRIWSPIEPKDDRDPNTIPEEERDYFLERRYPAFGNLVP
RDVASRAISQQINKGLGVGPLHNSAYLDFRDAIERLGENTIRERYSNLFQMYEEAIGENP
FKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECSWTYHGANRLGANSLLSASVDGW
FTLPFTIPNYLANHLGEAKLPEDAPEAVAAVARAQARIDKLMNIKGDDPHGPEYYHRQLG
DILYFSCGVARNIEDLKAGIENIRKLRKEFWANLRITGEAEEMNQVLEYACRVADYIDLG
ELMCVDALDRDESCGAHFRDDHLSPEGEAERDDDNWCFVSAWEPGAHENEFIRHAEPLTF
ESIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaactctgaaaccgctactcgccctgagttcacccagccagcctccatcgtc
gatggcgtgaaactgggcagcatccttgagtccaatgagcccaagggcgttcctaccaag
gacatgtgggagtaccagaaagatcacatgaacttggtctcccccctgaaccgtcgtaag
ttcacggttcttgttgtgggaaccggactttccggtggtggcgctgctgctgccctcggc
gagctgggatacaacgttaaagtcttcacttaccacgatgctcctcgtcgtgcgcactct
attgctgcgcagggtggcgtgaactccgcccgtggcaagaaagtggataacgacggcgct
taccgccacgtgaaagacaccgtgaagggcggcgactaccgttgtcgcgaatctgattgt
tggcgcctggcgtacgaatccgtacgcgtcatcgatcacatgaatgctatcggtgcacct
ttcgcccgtgagtatggcggaaccctagctacccgttccttcggtggtgtgcaggtttcc
cgtacgtactacacgcgtggtcaaacaggccagcagcttcagctatctggcgcagctgcg
ctgcagcgtcagattggtcttggaaccgtagagatcttcacgcatgcagacatgcatgac
ttgatcatcaccgaggaaaacggcaagaaaacctgccgcggtatcgttactcgtaacctg
atcactggtgagctcacacctcacacgggccacgcagtcatcttggctactggcggttac
ggcaacgtttatcacatgtctacgctggctaagaactccaatgcatcggcaatgatgcgt
gcgtacgacctcggcgcttatcttgcttctccgtcgttcattcagttccacccgaccggc
cttccggtcaactcggaatggcagtcgaagacgatcctgatgtctgagtctttgcgtaat
gacggccgcatctggtccccaattgagcccaaggacgatcgcgaccccaacacgatcccc
gaagaagagcgcgattacttcctggagcgccgttacccggcattcggtaacctcgtgcct
cgcgacgtggcatcgcgtgctatttctcagcagatcaacaagggactcggcgttgggcct
ctgcacaactccgcatacctggacttccgtgacgcaattgagcgtctgggcgagaacacg
atccgtgagcgctactccaacctcttccagatgtatgaagaagcgatcggcgaaaacccg
ttcaaggctccgatgcgtattgcaccgacctgccacttcaccatgggtggtctgtggacg
gacttcaatgagatgacctccatcgacggtctctttgccgctggtgagtgctcctggact
taccacggtgcaaaccgtctgggcgctaactccttgctctctgcttctgttgatggctgg
ttcaccttgccatttaccattccgaactacttggctaaccaccttggagaagccaagctg
cctgaggacgctcctgaagcagtagcagcagtcgcccgagctcaggctcgtattgacaag
ctcatgaacatcaagggtgatgaccctcatggccctgagtactaccaccgccagctaggc
gatatcctctacttctcttgtggcgttgcccgcaacatcgaagacctgaaggccggcatt
gagaacatccggaagctccgcaaggaattctgggcgaacctccgcattaccggcgaggca
gaggaaatgaaccaggttcttgagtacgcatgtcgcgtagcagactacatcgatctcggc
gagctcatgtgcgttgacgcactcgaccgcgacgagtcctgtggtgcgcacttccgtgac
gatcacctctctcctgaaggtgaagcggagcgtgacgacgataactggtgcttcgtttct
gcatgggagccaggcgcgcatgaaaacgagttcattcgccatgctgagccactcacgttc
gaatcgatcccgctgatgacaaggaactacaagtaa

DBGET integrated database retrieval system