KEGG   Corynebacterium ulcerans FRC11: CulFRC11_0286Help
Entry
CulFRC11_0286     CDS       T03408                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cus  Corynebacterium ulcerans FRC11
Pathway
cus00020  Citrate cycle (TCA cycle)
cus00190  Oxidative phosphorylation
cus00650  Butanoate metabolism
cus01100  Metabolic pathways
cus01110  Biosynthesis of secondary metabolites
cus01120  Microbial metabolism in diverse environments
cus01130  Biosynthesis of antibiotics
cus01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CulFRC11_0286 (sdhB)
   00650 Butanoate metabolism
    CulFRC11_0286 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CulFRC11_0286 (sdhB)
Enzymes [BR:cus01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CulFRC11_0286 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CulFRC11_0286 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_4 Fer4_2 Fer4_6 Fer4_15 Fer4_21 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AIU31883
LinkDB All DBs
Position
306752..307501
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPNSEGHFESIDVEDAVAQMSILELLDHVNTGLVEEGKEPFVFASDCRE
GICGTCGLLVNGRPHGLDKNKPSCQQRLDHVADGSTLKIEPFRSAAYPVIKDLAVDRSAL
DRVMQKGGYVSINAGTAPDADTIYQNHEKAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLALMPLGREERGKRARNMIDELETNFGHCSLYGECADVCPAGIPLSAVAAINKERA
RAFFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccatcttgaaatttggcgtcaggccggtcctaacagcgaaggtcatttcgag
tccatcgacgtcgaagacgccgtagcacagatgtcgatccttgagcttctggaccacgtc
aatacaggcttggtcgaagaaggcaaagagcctttcgtcttcgcctctgactgccgtgaa
ggcatttgtggcacctgtggcctgctggttaacggccggccacacggcttggacaagaac
aagccttcctgccagcagcgcctcgatcacgtggcagacggctcgaccctaaagattgag
cctttccgttctgctgcttaccctgtgatcaaggaccttgcggttgatcgctcggctctt
gaccgcgtgatgcaaaagggtggctacgtttccatcaacgcaggcacggctcctgatgcg
gacactatttaccagaaccatgagaaggctgagcttgctcttgaccatgctgcatgcatt
ggttgtggtgcctgcgtggctgcctgccccaacggcgcagcacacctgttcaccggagca
aagctcgttcaccttgctcttatgcctttgggccgtgaagagcgaggcaagcgtgcccgc
aatatgattgatgagcttgagaccaactttggtcactgctcgttgtacggtgagtgcgcc
gatgtctgcccggcaggtattccgctatccgctgttgcggctattaacaaggagcgtgcc
cgcgctttcttccgcggtaaggacgactaa

DBGET integrated database retrieval system