KEGG   Corynebacterium ulcerans FRC11: CulFRC11_1187Help
Entry
CulFRC11_1187     CDS       T03408                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cus  Corynebacterium ulcerans FRC11
Pathway
cus00620  Pyruvate metabolism
cus00680  Methane metabolism
cus01100  Metabolic pathways
cus01120  Microbial metabolism in diverse environments
cus01200  Carbon metabolism
Module
cus_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CulFRC11_1187 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    CulFRC11_1187 (ppc)
Enzymes [BR:cus01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CulFRC11_1187 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIU32763
LinkDB All DBs
Position
complement(1296014..1298833)
Genome map
AA seq 939 aa AA seqDB search
MPVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGTAAFDRVEAARQLAFKISRKEAQVE
DLVSLLKDISAADAISIIRAFSHFALLANMVEDLHDELGRLRRQEAGEEDPDSTLGATWK
KLAKAGVTSEDVSGLLGNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLEERHAILGADPN
ALTATRLEENTRRIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYKLSLLTAIPEINKQV
ADHIQREYGVSSEDALRSLFIKPGSWIGGDHDGNPYVTAETLHYATTRAAETVLKFYARE
LHQLEHELSLSDRLTDVSQTLRVLADLGHNDVPSRVDEPYRRAVHGVRGRVLATLASRIG
TEAVEGSWYARHDAYSDPNELAADLDIIDASLRRTHDELIADDRLLRIRTAVSSFGFHLY
SMDLRQNSESYEDVLTELFEQAHVTKHYRELDENEKIRVLTAELSSPRPLIPRDGASYSE
VTQRELDIIAEAKRAVDAFGPMMIPHSIISMAESASDILEPMVLLKEFGLIRIQEGQLTG
HIDVIPLFETIDDLQNGAKILQDLWRIPLYRSYVEQRNNLQEVMLGYSDSNKDGGYLAAN
WALYAAETDLVSMCKQHGVALRLFHGRGGTVGRGGGPSYDAILAQPHGAVQGSVRVTEQG
EIISAKYGSVGAARRNLEALASATLEASLLTIDQVEEQYPEAYEIMGEISRLSQRKYSRL
AHEDPGFIEYFTSSTPLEEIGDLNIGSRPSSRKQTQSIDDLRAIPWVLSWSQSRVMLPGW
YGVGSALYEWVEKGCVRTAELSADERLAILQKLNGSWPFFSSVLSNMAQVMSKAEMQLAK
LYSGLVADQEAANRIFADISAEFDLTKTMFLKITGFSGLLDDNPMLARSVRSRYPYLLPL
NTLQLEMLRRYREGDTDPKVVHGIRLAMNGLATALRNSG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtaaaagctacgtctgcaggtccactatccgaacagcttgttgaggatatacgc
tttctaggtgcacttttgggggaggtgatcaaagaacaagagggaacggcagcctttgac
cgagtcgaagcagcgcgacagctggcttttaaaatctcgcgcaaagaggcacaggttgaa
gacttagtatcactgctcaaagatatttcagcagcagatgcgatatcgattattagagcg
tttagccattttgcgttgctagcaaacatggtggaggacttgcacgatgaactgggtagg
ctccggcgacaagaagccggtgaagaagacccagattcaacgttgggtgcgacttggaaa
aagcttgctaaggctggagtaacgagcgaagacgtgtccggtttactcggtaactttcaa
gttgccccggtgcttaccgctcaccctacggaaacccgtagacgtacgatttttgatgcg
caagagcatatgactactttgctcgaagaacgtcatgcgattctgggcgcagatccgaat
gcgctgacggctacgcgtcttgaagagaatactcgtcggattcgccggtggctgactctc
atctggcagaccgcgcttatccgggtggcccgccctaggattgaggacgaggtagaagtt
ggattgcgatactataagctctccttgcttactgcgatccctgagatcaacaagcaagtg
gctgatcatatccagcgagaatatggtgttagctctgaagatgctttgcggtcgctattc
attaaacctggaagctggatcggtggcgatcatgacggtaacccgtatgtcactgcggaa
actctgcactatgcgacgacacgagcagccgagactgtattaaagttttatgcacgcgaa
ctgcatcaacttgaacatgagttatcgctgtcggataggttgactgatgtgagccagact
ctgcgcgtgcttgctgatttaggacataacgacgtcccatcgcgggtcgacgagccttat
cgccgtgccgtccacggtgtgcgcggtagagtacttgctacgctagcttctcggattggt
acagaagcggtagaaggctcgtggtatgcccgtcatgatgcttattctgatccaaatgag
cttgcagcagatttggatatcattgatgcttccttgcggagaacgcacgatgaactcatc
gcagatgatcgcttgttgcgcatcaggacagcggtatcaagctttggtttccatctctat
tcgatggatttgcgccaaaattctgagagctatgaggatgtgcttaccgagctctttgag
caagcccacgtaaccaagcactatcgcgaattggacgagaacgaaaagattcgcgtttta
actgctgagctatcgtcaccgagaccccttataccgcgcgatggtgcctcatatagtgag
gtaacccagcgtgagctagacattattgctgaagcaaagcgtgcagtggatgcctttggc
ccaatgatgatcccacattcgattatctcgatggcagaatctgcgagcgatatcctcgaa
ccgatggtcctcctgaaagaattcggattaatccgcattcaggaaggacaacttaccggg
cacattgacgtcataccgctttttgaaacgatcgatgatctgcaaaatggtgccaagatt
ctccaagatctatggcggataccgttgtatcgcagttatgtggagcaacgaaataatctt
caagaggtcatgcttggctattccgattccaataaagatggtggctatctcgccgcaaac
tgggctctgtatgctgccgaaactgatttagtaagcatgtgtaaacaacatggtgtagcg
ctgaggcttttccatggccgcggtggaaccgtaggacgcggcggcggcccctcttatgac
gctatccttgctcagccacatggtgctgtgcaaggcagtgtacgtgttacggaacaaggt
gagatcatctcagcaaaatatggttctgtgggtgcggctcgtcgtaacctagaagccttg
gcctcagccacgctggaggcgtcgctgcttacaatcgatcaggtagaagagcaatatcct
gaggcgtatgagattatgggtgaaatctcacgcttgagtcagcgaaagtattcgaggctt
gcgcatgaagaccctggttttattgagtacttcacatcctccacacctttggaagagata
ggcgaccttaacatcggctcgcgtccttcgtcgcgaaaacaaacccaaagtatcgacgat
ttacgcgcaattccatgggtgctcagctggtcgcagtcccgtgttatgctgcccggctgg
tatggagtaggcagcgctttgtatgaatgggtagaaaaaggctgtgtgcgcacagcggaa
ctctcagcagatgagcgccttgctattttgcagaagcttaatggttcctggccgttcttt
tcttctgtgctgtctaatatggcgcaggtgatgagcaaagctgagatgcaacttgcgaag
ctctattcgggattggtagcagatcaggaagctgcaaacagaatatttgctgatatttct
gccgaattcgatctcactaagacgatgttcctcaagatcaccggcttctcggggcttctc
gacgacaacccgatgcttgcacggtcagttcgctcgcgttacccgtatctgttgccgctt
aatacactgcaactcgaaatgctacgtaggtatcgcgaaggtgatactgatccgaaggtg
gtgcatggcattcgcctagctatgaacggcttggctaccgcgctgcgaaattctggctag

DBGET integrated database retrieval system