KEGG   Corynebacterium ulcerans FRC11: CulFRC11_1503Help
Entry
CulFRC11_1503     CDS       T03408                                 

Gene name
aroG
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cus  Corynebacterium ulcerans FRC11
Pathway
cus00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cus01100  Metabolic pathways
cus01110  Biosynthesis of secondary metabolites
cus01130  Biosynthesis of antibiotics
cus01230  Biosynthesis of amino acids
cus02024  Quorum sensing
Module
cus_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CulFRC11_1503 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CulFRC11_1503 (aroG)
Enzymes [BR:cus01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CulFRC11_1503 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2 Penicil_amidase
Motif
Other DBs
NCBI-ProteinID: AIU33072
LinkDB All DBs
Position
complement(1648076..1649464)
Genome map
AA seq 462 aa AA seqDB search
MSWTVDIPKDVLPDLPPLPDGLQQRFEDVIARDAKQQPIWDTKTAENVRKILESVPPIVV
APEVRELKKLLADVANGKAFLLQGGDCAETFESNTEPHIRANIKTLLQMAVVLTYGASTP
VIKMARIAGQYAKPRSSNLDENGLPNYRGDIVNGVEATEEARKHDPARMIRAYANSSAAM
NLVRALTSSGTADLHRLTGWNRQFVASSPAGARYEALAQEIERGLRFMNACGVTDNTLHS
ADIFCSHEALVVDYERALLRLAKNEDGETELYDLSAHQLWIGERTRGIEDFHVNFAAMIA
NPIGIKIGPTCTPEEAVAYADKLDPNFEAGRLTMVARMGHDKVRSVLPGIIRAVEDSGHK
VIWQSDPMHGNTFTSSNGYKTRHFDKVIDEVQGFFEVHRALGTHPGGIHIELTGENVTEC
LGGAEDITDVDLPGRYESACDPRLNTQQSLELSFLVAEMLRN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgagttggacagtagacattcccaaagacgttttgccagatcttccgccgttgccggat
ggattgcagcagcgatttgaagacgttatcgctcgtgatgcaaagcagcaaccaatttgg
gacacgaaaaccgccgagaatgttcgcaagatcctcgagtcggtgcctcctatcgtggtt
gccccggaagttcgtgagctaaaaaagctgcttgccgacgttgccaatggaaaggccttt
ttactccaaggcggggactgtgctgagacttttgagtccaacacggagcctcatattcgt
gccaacattaagacacttctgcagatggcagtggtgcttacttatggcgcttctactccg
gtcatcaagatggctcgtatcgcggggcaatacgctaaaccacgttcctctaatctcgat
gaaaatggcttgcctaattaccgtggggacatcgtgaacggggtggaagcgaccgaggaa
gctcgcaagcatgatcccgcacgtatgatccgtgcatatgctaactcctctgccgctatg
aatttagttcgtgcattaacgtcatcgggcaccgctgatttgcatcgattgacaggttgg
aataggcagttcgttgccagttctcctgctggagcgcgctatgaggcgctggcccaggaa
atcgagcggggattgcggtttatgaacgcctgtggtgttactgacaacacactgcattcc
gcagatattttttgttcccacgaggctctggtcgtggactacgagcgggctctgctgcgc
ttggcaaaaaacgaagacggagaaacagagctctatgatctgtctgcgcatcagctctgg
attggcgagcgcacacggggaatcgaagatttccacgttaacttcgcagcaatgatcgcc
aaccctataggcatcaagatcggtcctacttgtactcccgaagaagccgtggcgtatgca
gacaagctagatccgaattttgaagcgggccgtctcaccatggttgcccgcatgggtcat
gataaagttcgttccgtcttgccaggcatcatccgagctgtcgaggactccggacacaaa
gtgatttggcagtcggacccgatgcatgggaacacttttacttcttccaatggctataag
acccgtcactttgacaaagtgattgatgaggttcagggcttttttgaagtccatcgtgcg
ctaggtacacacccaggtggcattcacattgaacttactggtgagaatgtcactgaatgc
cttggtggagcagaagatatcacggatgtggatcttccgggacgttatgagtctgcttgt
gatccccgtcttaacactcagcaatcgctggagttgtccttcctagtcgctgagatgctg
cgaaactaa

DBGET integrated database retrieval system