KEGG   Corynebacterium uterequi: CUTER_01115Help
Entry
CUTER_01115       CDS       T03957                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cut  Corynebacterium uterequi
Pathway
cut00020  Citrate cycle (TCA cycle)
cut00190  Oxidative phosphorylation
cut00650  Butanoate metabolism
cut01100  Metabolic pathways
cut01110  Biosynthesis of secondary metabolites
cut01120  Microbial metabolism in diverse environments
cut01130  Biosynthesis of antibiotics
cut01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUTER_01115 (sdhA)
   00650 Butanoate metabolism
    CUTER_01115 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CUTER_01115 (sdhA)
Enzymes [BR:cut01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CUTER_01115 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CUTER_01115 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 DUF3376
Motif
Other DBs
NCBI-ProteinID: AKK10243
UniProt: A0A0G3HE69
LinkDB All DBs
Position
230981..232975
Genome map
AA seq 664 aa AA seqDB search
MSNNDNFTNPQSSVAGVTVGRILDNAEPKGVSTKDMWEYHKDHMNLVSPLNRRKFSILVV
GTGLAAGAAAAALGELGYQVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAYRHVKD
TVKGGDYRGRESDCWRLAVESVRVIDHMAAIGAPFAREYGGTLATRSFGGVQVSRTYYTR
GQTGQQLQLSTTSALLRQIHLGNVEMFTHSDMQELIVTEKDGVKRCEGIVTRNLITGELE
AHTGHAVILGTGGYGNVYQMSTLAVNSNASAIMRAFEQGAFFASPAFVQFHPTGLPVNST
WQSKTILMSESLRNDGRIWTPKEKGDDRDPNTIPEEERDYFLERRYPAFGNLVPRDVASR
AISQQINAGFGVGPLHNSAYLDFKDAFQRLGVDTVDSRYSNLFKMYEEATGENPHDTPMR
IAPTCHFTMGGLWTDFNEMTSIDGLFAAGECSWTYHGANRLGANSLLSASVDGWFTLPFT
VPNYLANHLNEPVLATDSPEALAALERAENRVTTLLSVQTEDPKPAEDFHRELGEILYRG
CGVSRTEAGLTEALDAVRDLRQRFWKDVRVPGGNDYMNQALEYALRVSDYIELAELMCID
ALDRDESCGAHYREDHLTDDGEAERDDATWCFVSAWERTGQSQYTRHAEPLRFESIPLQT
RNYK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaacgacaacttcaccaacccccagtcctccgtcgccggagtgactgtcggt
cgcattcttgacaacgccgagcccaagggcgtctcgaccaaggacatgtgggagtaccac
aaggaccacatgaacctggtctccccgctcaaccgccgcaagttcagcatcctcgtggtc
ggcaccggcctcgccgccggcgccgccgccgcggccctcggcgagctgggctaccaggtg
aaggccttcacctaccacgacgcgccgcgccgcgcccactccatcgccgcacagggcggc
gtcaactccgcccgcggcaagaaggttgacaacgacggcgcctaccgccacgtcaaggac
accgtcaagggcggcgactaccgcggccgcgagtccgactgctggcgcctggccgtcgag
tcggtccgcgtcatcgaccacatggccgccatcggcgcccccttcgcccgcgagtacggc
ggcaccctggccacccgctccttcggtggtgtgcaggtctcccgcacctactacacccgc
ggccagaccggccagcagctgcagctgtcgaccacctcggccctgctgcgtcagatccac
ctcggcaacgtggagatgttcacgcattccgacatgcaggaactcatcgtcaccgagaag
gacggcgtgaagcggtgcgagggcatcgtcacccgcaacctcatcacgggcgagctggag
gcccacaccggccacgcggtcatcctcggcacgggcgggtacggcaacgtctaccagatg
tccacgctggcggtgaactccaacgcctcggcgatcatgcgcgccttcgagcagggtgcc
ttcttcgcctccccggcgttcgtgcagttccacccgaccggcctgccggtcaactccacg
tggcagtccaagaccatcctcatgtccgagtcgctgcgtaacgacggccgcatctggacc
ccgaaggaaaagggcgacgaccgggacccgaacaccatcccggaggaggagcgcgactac
ttcctggagcgccgctacccggccttcggcaacctggtcccgcgtgacgtcgcctcccgc
gcgatctcccagcagatcaacgccggcttcggcgtcggcccgctgcacaactccgcctac
ctggacttcaaggacgccttccagcgcctgggcgtggacacggtggattcccgctactcc
aacctcttcaagatgtacgaagaggcgaccggcgagaacccgcacgacaccccgatgcgc
atcgccccgacctgccacttcaccatgggtggcctgtggaccgacttcaacgagatgacg
tccattgacggcctcttcgccgctggcgagtgctcctggacctaccacggcgcgaaccgc
ctgggcgcgaactcgctgctgtctgcgtccgtcgacggctggttcaccctgccgttcacg
gtgccgaactacctggcgaaccacctcaacgagccggtgctcgccaccgactcgccggag
gccctcgccgcactggagcgcgccgagaaccgcgtcaccacgctgctgtccgttcagacc
gaggacccgaagccggcggaggacttccaccgcgagctcggcgaaatcctctaccgcggc
tgtggcgtgtcccgcaccgaggccggcctgaccgaggccctcgacgcggtgcgcgacctg
cgtcagcgcttctggaaggacgtgcgcgtccccggcggcaatgactacatgaaccaggcg
ctggagtacgccctgcgcgtctccgactacatcgagctcgccgagctcatgtgcatcgac
gccctcgaccgcgacgagtcctgcggtgcccactaccgcgaggatcacctcaccgacgat
ggcgaggccgagcgcgacgacgccacctggtgcttcgtctcagcctgggagcgcactggc
cagagccagtacacccgccacgctgagccccttcgtttcgaatcgatcccgctgcagaca
aggaactacaagtaa

DBGET integrated database retrieval system