KEGG   Corynebacterium uterequi: CUTER_01120Help
Entry
CUTER_01120       CDS       T03957                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cut  Corynebacterium uterequi
Pathway
cut00020  Citrate cycle (TCA cycle)
cut00190  Oxidative phosphorylation
cut00650  Butanoate metabolism
cut01100  Metabolic pathways
cut01110  Biosynthesis of secondary metabolites
cut01120  Microbial metabolism in diverse environments
cut01130  Biosynthesis of antibiotics
cut01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUTER_01120
   00650 Butanoate metabolism
    CUTER_01120
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CUTER_01120
Enzymes [BR:cut01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CUTER_01120
    1.3.5.4  fumarate reductase (quinol)
     CUTER_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_16 Fer4_18 Fer4_2 Fer4_4 Fer4_6 Fer2 Fer4_15 Fer4_3 Fer4_21 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AKK10244
UniProt: A0A0G3HAA2
LinkDB All DBs
Position
232975..233724
Genome map
AA seq 249 aa AA seqDB search
MKLTVEIWRQAGPNNEGAFETVSVDDAVPQMSVLELLDHINAGIVRRGEEPYAFASDCRE
GICGTCGLMVNGRPHGPHQNSPACQQRLVDFNDGDTIKLEPLRSAAFPVIKDMVVDRSAL
DRVLYQGGYVSIQAGTAPDADTLHQGQNEAEFALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLMPLGKEERGKRARQMVDELETNFGHCSLYGECADVCPAGVPLSAVGAVNTERA
RAAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcactgtagagatctggcgccaggccggaccgaacaacgagggcgccttcgaa
accgtctcggtggacgacgccgtcccgcagatgtccgtcctggagctgctcgaccacatc
aacgccggcatcgtgcgccgcggcgaggagccgtacgccttcgcctccgactgccgcgag
ggcatctgcggcacctgtggcctcatggtcaacggccgtccccacggcccgcaccagaac
tccccggcctgccagcagcgtctcgtcgacttcaacgacggtgacaccatcaagctggag
ccgctgcgctccgccgccttcccggtcatcaaggacatggtcgtcgaccgttccgcgctg
gaccgcgtgctctaccagggtggctatgtctccatccaggccggcaccgccccggacgcc
gacaccctgcaccagggccagaacgaggccgagttcgccctcgaccacgccgcgtgcatc
ggctgcggcgcgtgcgtcgccgcctgcccgaacggtgcggcccacctgtttaccggcgcc
aagctggtgcacctgtcgctcatgcccctgggtaaggaagagcgcggcaagcgtgcccgc
cagatggtggacgagctggagaccaacttcggtcactgctcgctgtacggcgagtgcgcc
gacgtctgcccggccggcgttccgctgagcgccgtcggtgcggtgaacaccgagcgtgct
cgtgcggcattccgcggcaaggacgactaa

DBGET integrated database retrieval system