KEGG   Corynebacterium uterequi: CUTER_01555Help
Entry
CUTER_01555       CDS       T03957                                 

Definition
(GenBank) laminin G domain-containing protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
cut  Corynebacterium uterequi
Pathway
cut00511  Other glycan degradation
cut00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CUTER_01555
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CUTER_01555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cut02042]
    CUTER_01555
Enzymes [BR:cut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CUTER_01555
Bacterial toxins [BR:cut02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CUTER_01555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 Laminin_G_2 BNR Laminin_G_3 Laminin_G_1 DUF4185
Motif
Other DBs
NCBI-ProteinID: AKK10327
UniProt: A0A0G3HGR3
LinkDB All DBs
Position
328159..330417
Genome map
AA seq 752 aa AA seqDB search
MYLDHRAGAGVFTVPEAAVQRHGSLHLDFAATADAELLRASGADGWITLSLTGGRLDGEI
HSASEHRRLDAEDAVGLNDGAIHSVTLTVNDSGTHLFVDGYEAFSATTQLWFRDLGIEEF
TVDPAEIITVYRVAVLEPGLTPRAAVALAVAAEPFVEFAAAELSTRDVQRCSTLRKGAIR
ARFRTRGRGQHGVAVTVVGVDGVIRMGIDDGGNLYYRVWLSDELVVEALAEGRWDDGNDH
DVVAVVGHGAVDLYADGYQVVHEPGMAFFADLGSISQVLAGMDADGRRLFGEVSEAHIFD
AVLSDHQVKRLASVEPLETRALFDTGLLDSASYRIPSLVTLASGVVVAGADQRVSIPNDA
PNDINFTIRRSLDGGRTWLDVQTVIEHPGSGLLGASATDSVLVQDRDTGRLFCVLDFFPG
GIGQPNAALGRGFDDCGRRILHDEEGMIYLLKDDGEVLTAEGKPTSYRVASDGNVNRGGN
IYLADGVDPNQTLLAHPTSYLQIIYSDDDGETWSAPRDITAEVKEEWMSFCGTSPGNGIQ
LSRGEHAGRILIPLYHNNEHRSAFSCAALYTDDGGQTWHRGASTNDGRNIDGQVVSSRDL
IYEPAFSYESVFVEDSQGRVHVWMRNNNAAGRVAHAVSDDGGTSWGQVDFVDAIPEIFSQ
PNAIAVDVDGHPGIVFANASQLVPYRGRGVLRLSLDDGATWPHNRVFNPKHYVYQCMTQL
PNGDIGLLWERERQGLFLSIVPLTWLTSSLQG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgtacctcgatcaccgcgccggcgcaggagtattcactgtccccgaggctgccgttcaa
cgacacggctccctacacctggatttcgccgcgaccgcggacgccgagctgcttcgtgcc
tccggggccgatggctggattacgctgagcctcactggtgggcggctcgacggtgaaatc
cactcggcgagcgagcatcgcagactcgatgccgaggacgcggttggcctcaacgatgga
gccattcactctgtgacgctcaccgtcaatgacagtggaacccatctcttcgttgacggc
tacgaggcgttctccgccacgacgcaactgtggttccgtgacctcggcatcgaggaattt
acggtggatcccgcagagatcatcacggtgtatcgcgtggcagtgcttgagccgggtttg
accccacgggcagcagtggcgctggccgtcgcggcggaaccgttcgtcgaattcgccgct
gctgagctatcaacgcgggacgtgcaacgatgctccacgctgcgcaagggggccatccgc
gcccgcttccggactcgtggccgcggtcagcacggtgtcgccgtcacggtggtcggtgtg
gatggcgttatccggatgggaatcgacgacgggggaaacctctattatcgcgtctggtta
agcgatgaattggtggtggaagccctagccgaagggcgatgggacgacggtaatgaccac
gacgtcgtggccgtcgtcggccatggggcagtcgatctctacgcggatggttaccaggtt
gtccacgaaccgggaatggccttcttcgccgacctggggagcatctcacaggtgctggcg
ggaatggacgccgatggcagacggttgttcggcgaagtttcagaagctcatatctttgat
gcggtgctcagcgaccaccaggttaagcgcctggcgtccgtcgagccgctggagacccgg
gcgttgttcgacaccggattgttggactctgccagctaccgcatcccttcgctggtgacc
ttggcctctggtgtggtggtggcgggggcggaccagcgcgtgagtatcccgaatgacgcg
ccgaatgacattaatttcaccatccgacgctccctcgacggcgggcggacctggttggac
gtacagaccgtcatcgagcacccgggtagcggattgctcggcgcgtcggcaacggattcg
gtgctggtgcaggaccgggacaccggccggttgttctgcgtccttgacttcttccctggt
ggcatcggccagcccaacgccgcgctcgggagaggctttgacgattgtggacgccgaatc
ctccacgacgaagaaggcatgatctacctgcttaaagacgacggtgaggtgctcaccgcg
gaggggaaacctaccagctaccgggtggcctcggacggcaatgtcaaccgcggcggcaac
atctacttagccgacggcgtggaccccaatcagacgctgcttgcacaccccacgagctac
cttcagatcatttactccgacgacgacggcgagacgtggtccgccccgcgtgacatcacc
gcggaagtgaaagaggagtggatgagtttctgcggaacctcacccggcaacggcatacag
ctgtcccgcggcgagcacgccgggcgcatcctcatcccgctctatcacaacaacgagcac
cggtccgccttctcgtgtgctgctttgtatacggacgacgggggtcagacgtggcatagg
ggcgcatcgaccaacgacggtcgaaacatcgacgggcaggtggtgagctcccgcgacctc
atctacgaacccgccttcagctacgagtcggtattcgtggaagactcccagggtcgggtg
cacgtgtggatgcgcaacaacaacgctgctggacgagtggcccacgccgtatccgacgac
ggcgggaccagctggggccaggtggacttcgtggacgccatcccggagatcttctcccag
cccaacgccatcgccgtcgacgtcgacggccaccccggcattgttttcgccaacgcctcc
cagctggtgccctaccgcgggcgcggcgtgctgcggctgagcctcgacgacggggccacg
tggccccataaccgggtgttcaatccgaagcactacgtctaccaatgcatgacgcagctg
ccgaatggcgacattggcttgttgtgggagcgcgagcggcaaggattattcctcagtatt
gtcccgctgacgtggctaacgtcgtcgctgcagggataa

DBGET integrated database retrieval system