KEGG   Corynebacterium uterequi: CUTER_06675Help
Entry
CUTER_06675       CDS       T03957                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine(55) synthase
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
cut  Corynebacterium uterequi
Brite
KEGG Orthology (KO) [BR:cut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cut03016]
    CUTER_06675 (truB)
Enzymes [BR:cut01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     CUTER_06675 (truB)
Transfer RNA biogenesis [BR:cut03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CUTER_06675 (truB)
 Prokaryotic type
    CUTER_06675 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2 DKCLD PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AKK11324
UniProt: A0A0G3HDD6
LinkDB All DBs
Position
1397772..1398665
Genome map
AA seq 297 aa AA seqDB search
MTDSLSTSGLVVVDKPAGMTSHDVIARLRRILGTRKVGHAGTLDPMATGVLVVGVERGTK
FLAHLVATTKSYDATIRLGAATTTDDAEGETLRSTDASGVTDEAIIAGVAALSGDILQRP
AAVSAIKVDGRRAHERVRDGEEVVLPARPVTVSRFDVLDVRRTGRWVDLDVSVDCSSGTY
IRSLARDLGEGLGVGGHLTALRRTAVGEFRLDDALTLDELADAPRLSLNLDEALTRCYPT
LELTTDEARDLAMGKWLPARGLRGIHAGVSPEGRAVALVAEKGRRLATVFVARPSTL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactgattcgctctctacttccgggctcgtcgtcgtggacaagccagccggtatgacg
tcgcacgacgtcatcgcccggctccgccgaatcctcgggacccgcaaggtcggccacgcc
gggacgctcgaccctatggccaccggggtgctcgtggtgggcgtggagcgtggcacaaag
ttcctcgctcatctggtcgccaccacgaagtcgtacgacgccaccatccgccttggtgcc
gctacgaccaccgacgacgcggagggagagacgcttcgcagtaccgatgccagcggcgtc
acagacgaggcgatcattgccggagtggcggcactgtccggggatatcctccaacggccg
gcggcggtatcggccatcaaggtcgatggccggcgggcccacgaacgagtccgagacggc
gaggaggtcgtccttcctgctcggccggtgaccgtgagccggttcgacgttctcgacgtt
cgacgcacggggcgctgggtggacctcgacgtcagcgtcgactgctcctccggtacctac
atccgttccctcgcccgtgacctcggtgaaggcctcggcgtgggcgggcatctcacggcg
ctgcggcgcaccgccgtcggtgagtttcgactcgacgacgcgctcacgctcgacgaactg
gccgacgccccgcggctgtcgcttaacctcgatgaggccctcacccgctgctaccccacc
ctcgaactcactaccgacgaggcccgtgatctcgctatgggtaagtggctgcccgcccgg
gggttgcgcggtattcatgccggggtctcccccgagggccgggcggtggcgttggtcgcg
gagaagggccgtcgcctggccacggtgttcgtcgcccgcccgtcgacgctgtaa

DBGET integrated database retrieval system