KEGG   Cupriavidus sp. USMAA2-4: BKK79_02600Help
Entry
BKK79_02600       CDS       T05072                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
cuu  Cupriavidus sp. USMAA2-4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh YadA_anchor
Motif
Other DBs
NCBI-ProteinID: AOY90825
UniProt: A0A1D9GTD8
LinkDB All DBs
Position
1:complement(592728..594161)
Genome map
AA seq 477 aa AA seqDB search
MQQRDKLFINGKWVAPHGAGHIDVIHSATEAVMGRIPEGSTRDAEDAILAARAAFDGWAA
TPAAVRAEYIRKIAEGLKARSEELAQLIAGEVGMPIKMARAIQVGGPVYNWGQAAKLLEN
FHFEEEVGNSLVVREPVGVVAAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPLNAF
VLAEVIEAAGLPPGVFNLVTGFGPVVGEVLASHPEVDMVSFTGSTRAGKRVSELASQTVK
RVALELGGKSASVILDDADLAAAVKGSVSACFLNSGQTCSAHTRMLVPRARYEEAKTIAK
QVAEAFTVGDPLQESTKLGPLISATQRERVTGYIRRGVNEGAELVTGGPDAPAGLDKGFY
VKPTVLGNVDPRATVAQEEIFGPVLSIICYDTEEEAVRIANDSIYGLGGGVWSGDEARAV
RVARRIRTGQVDINGGPFNMSAPFGGYKQSGNGREAGKYGLEEFLEYKSLQFKKPAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacgagacaaactcttcatcaatggtaaatgggtggccccgcacggcgcgggc
cacatcgatgtcatccattccgccaccgaggcggtgatgggccggattcccgaaggcagc
acccgtgatgccgaggacgccatcctggcggcccgtgccgcgttcgatggctgggccgcc
acgccggcggcggtgcgcgccgagtacatccgcaagattgccgagggcctgaaggcgcgc
agcgaggaactggcgcagctgatcgccggcgaggtgggcatgccgatcaagatggcgcgc
gcgatccaggtcggcggcccggtctacaactggggccaggcggccaagctgctggagaac
ttccacttcgaggaggaggtcggcaattccctggtggtgcgcgagccggtcggtgtggtg
gcggcgatcacgccgtggaactacccgctcaaccagatcacgctgaaggtcgcaccggcg
ctggcggcgggctgcacggtggtgctgaagccgtccgaggtggcgccgctcaacgccttc
gtgctggccgaggtgatcgaggccgccggcctgccgccgggcgtgttcaacctggtgacc
ggcttcggtccggtggtcggcgaggtgctggccagccacccggaagtcgacatggtgtcc
ttcaccggttccacccgcgccggcaagcgcgtgtcggaactggcctcccagacggtcaag
cgggtcgcgctggagctgggtggcaagtcggcctcggtgatcctggacgatgccgacctg
gcggccgcggtcaagggcagcgtcagcgcctgcttcctgaactccggccagacctgttcg
gcccacacccgcatgctggtgccgcgcgcccgctacgaagaggccaagaccatcgccaag
caggtggccgaagccttcaccgtgggggatccgctgcaggaaagcaccaagctcggaccg
ctgatctccgccacgcagcgcgagcgcgtgaccggctacatccgccgcggcgtcaacgaa
ggtgccgaactggtgaccggtggtccggatgcgccggcgggcctggacaagggcttctac
gtcaagccgacggtcctgggcaacgtcgatccgcgcgcgaccgtggcacaggaggaaatc
ttcggaccggtgctgtcgatcatctgctacgacaccgaggaagaggccgtgcgcatcgcc
aacgacagcatctacggcctgggcggcggcgtgtggtcgggtgacgaagcgcgcgccgtg
cgcgtggcgcgccgcatccgtaccggccaggtcgacatcaacggcggccccttcaatatg
tcggcgccgttcggcggctacaagcagtcgggcaacggccgcgaggccggcaagtacggc
ctggaggagttcctcgagtacaagtcgctgcaattcaagaagccggcggcctga

DBGET integrated database retrieval system