KEGG   Cupriavidus sp. USMAA2-4: BKK79_02900
Entry
BKK79_02900       CDS       T05072                                 

Definition
(GenBank) type VI secretion system-associated protein
  KO
K11901  type VI secretion system protein ImpB
Organism
cuu  Cupriavidus sp. USMAA2-4
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cuu02044]
    BKK79_02900
Secretion system [BR:cuu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BKK79_02900
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AOY90878
UniProt: A0A1D9GTE1
LinkDB
Position
1:complement(668016..668549)
AA seq 177 aa
MSVVNSSQKFIARNRAPRVQIEYDVEVYGSEKRIELPFVMGVLADLSGTPAEPLPPVADR
KFLEVDINNFDERMKAMKPRAAFAVSNTLTGEGQLMVDMTFESIEDFSPAAVAGKVDALR
KLLEARTQLANLQTYMDGKSGAESLINQLLQDPALLQALAKAPKPKTSDGESDAAYS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtctgttgtgaacagttcgcagaaattcatcgcgcgcaaccgtgcgccgcgcgtgcag
attgagtacgacgtcgaggtgtacggctcggagaagcgcatcgagctgccatttgtcatg
ggggtcctggccgatctgtccggaacgccagcggagccgctaccgccggtagccgatcga
aagttcctggaagtcgacatcaataacttcgatgagcgcatgaaggccatgaagccgcgc
gcggcattcgccgtgtccaacaccctgacgggcgaggggcaactgatggtcgacatgacg
ttcgagagcatcgaggacttctcgccggcggcggttgccggcaaggtcgatgcgctcagg
aagctcctcgaagcccgcacgcagctcgccaacctgcagacctatatggatggcaagtcc
ggtgccgaatcgctgatcaaccaactgttgcaggacccggcactgctgcaggcgctggcc
aaggcgccgaagcccaagacctccgatggcgaaagcgacgccgcctattcctga

DBGET integrated database retrieval system