KEGG   Cupriavidus sp. USMAA2-4: BKK79_13475Help
Entry
BKK79_13475       CDS       T05072                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00473  D-Alanine metabolism
cuu00550  Peptidoglycan biosynthesis
cuu01100  Metabolic pathways
cuu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BKK79_13475
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKK79_13475
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BKK79_13475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
    BKK79_13475
Enzymes [BR:cuu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BKK79_13475
Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
 Precursor biosynthesis
  Amino acid ligase
   BKK79_13475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST ATPgrasp_Ter ATP-grasp_4 RimK CPSase_L_D2 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AOY92670
UniProt: A0A1D9GZ38
LinkDB All DBs
Position
1:3050626..3051609
Genome map
AA seq 327 aa AA seqDB search
MSFVAHPQIDPRSLGKVGVLFGGRSAEREVSLMSGRGVLAALQSRGVDAHAFDPAVQGVA
ELAAAGFDRVFIALHGRYGEDGTMQGLLEQLGIPYTGSGVLASALSMDKQATKRLWMTHG
LPTPRFAMLQAGSDFTAVVAELGLPLIVKPAREGSSIGLTKVTDAAQMREAYEKAAALDR
DVIAETFIDGAELTCPLVGEGDDAAALPVIRIVAPGANYDYQNKYFTDDTQYLCPSGLPE
ALEREVQDLAVNAYRVLGCRGWARADVMLRADGKPFLLEMNTSPGMTGHSLVPMAARAAG
ISYEDFVMQVLAAATLDLQPNEHWKPE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgtcgcccatccccagatcgatccccgctcccttggcaaggtcggcgtgctg
ttcggcggccgctcggccgaacgcgaggtatcgctgatgtccggccgcggcgtgctggcg
gcgttgcagtcgcgcggcgtggatgcccatgccttcgatccggccgtgcagggcgtggcc
gagctggccgcggcgggattcgaccgcgtcttcatcgcgctgcacggccgttacggcgag
gacggcaccatgcagggcctgctcgagcagctcggcattccctatacgggcagcggcgtg
ctggcctcggccttgtcgatggacaagcaggccaccaagcggctgtggatgacccacggc
ctgccgacgccgcgcttcgccatgctgcaggccggctccgacttcaccgccgtggtggcc
gagctggggctgccgctgatcgtcaagccggcgcgcgagggttcgtcgatcggcctgacc
aaggtgaccgacgcggcgcagatgcgcgaggcctacgagaaggcggcggcgctcgaccgc
gatgtcatcgccgagaccttcatcgatggcgcggagctgacctgcccgctggtaggggag
ggcgatgacgccgcggcgctgccggtcatccgcatcgtcgcgcccggcgccaactacgac
tatcaaaataagtactttactgacgatacccaatacctgtgcccgtcgggcctgccggag
gcgctcgagcgcgaagtgcaggacctggcggtcaatgcctaccgcgtgctgggttgccgc
ggctgggcgcgtgccgacgtgatgctgcgcgccgacggcaagcccttcctgctggagatg
aacacctcgccgggcatgaccggccattcgctggtgccgatggcggcgcgtgccgcgggc
atcagctacgaggacttcgtcatgcaggtgctggccgcggcgacgctggacctgcaaccg
aacgaacactggaagcccgagtag

DBGET integrated database retrieval system