KEGG   Cupriavidus sp. USMAA2-4: BKK79_16155Help
Entry
BKK79_16155       CDS       T05072                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BKK79_16155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cuu02000]
    BKK79_16155
Enzymes [BR:cuu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BKK79_16155
Transporters [BR:cuu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BKK79_16155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOY93160
UniProt: A0A1D9H0H3
LinkDB All DBs
Position
1:3636707..3637360
Genome map
AA seq 217 aa AA seqDB search
MAKTTLTISSKTYSSWSLRGWLLARFAGLEFEEVLVPPDDAAVRAELLLLSPSILVPCLR
HQGVTVWDTLAIAEYLNEVKPKAGLLPADRAARAHCRAICGEMHSGFAAMRAALPMNLKG
HFPGLKVWSRAQADIDRICAIWSECLDRYGGPYLFGSRTMADAMYAPVVTRFVTYGVQVD
PLPLAYCKQILAMPELQEWTAAAKQEPDEISELDVEF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagacgacgctcaccatcagcagcaagacttattcgtcctggtcactgcggggc
tggctgctggcccgtttcgccggcctggagttcgaagaggtgctggtgccgccggatgat
gccgcggtgcgggccgaactgctgctgctgtccccctccatcctggtgccctgcctgcgc
catcagggcgtcacggtatgggatacgctggccatcgccgaatatctcaacgaggtcaag
ccgaaggccgggctgctgccggccgatcgcgccgcgcgcgcgcactgccgcgccatctgc
ggcgagatgcactcgggtttcgcggccatgcgcgcggccttgccgatgaacctcaaggga
cacttccccgggctcaaggtgtggtcgcgcgcgcaggccgacatcgaccgcatctgcgcg
atctggagcgagtgcctggatcgctacggcggcccctacctgttcggctcacgcaccatg
gccgatgccatgtacgcgccggtggtgacgcgtttcgtcacctacggcgtgcaggtcgat
ccgctgccgctcgcctactgcaagcagatcctggcgatgcccgagttgcaggagtggacc
gccgcggccaagcaggagccggacgagatcagcgaactggacgtggagttctga

DBGET integrated database retrieval system