KEGG   Cupriavidus sp. USMAA2-4: BKK79_17710Help
Entry
BKK79_17710       CDS       T05072                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00564  Glycerophospholipid metabolism
cuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BKK79_17710
Enzymes [BR:cuu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BKK79_17710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 GIDA FAD_binding_3 NAD_binding_8 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AOY93431
UniProt: A0A1D9H0V3
LinkDB All DBs
Position
1:complement(3973080..3974687)
Genome map
AA seq 535 aa AA seqDB search
MPTPFTQILPPARADLLAGLAREPRWDVIVIGGGATGLGTAVDAASRGYRTLLVEAADFA
KGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLARNAPHLVWPLGFVVPAYQMLDQP
FYGIGLKVYDMLAGNLKLAGSRWLNHRETLAAAPTLAEHVGGRPLRGGNLYFDGQFDDAR
LAIALMRTLFDVGGTAVNYLRVTGLLQQGGAVTGVTVQDALGEACFALQAKCVINATGVW
VDAVRRMEDGQARTMVAPSQGVHLTLPRSFLPGQDAILIPRTDDGRVLFVVPWNGHTIVG
TTDTPRQDLPLEPRAAGDDVDFILETAARYLSRSPTRADVTSVWAGLRPLVKATGENTTA
SLSREHTILVSKGGLITVTGGKWTTYRKMAEDVVDTAIQRGLVARAAPCITTELALHGAQ
GLPADLPASGSGSPDRYYGNELGALRALPGQDEVLMAGSGLTAAHVRFAARHEMARRVED
VLARRNRALFLDARGASAAAPRVAAILAEELQHDAAWQTREVEDFRKLASGYMLD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgcctttcacccagatcctgccccctgcccgcgccgacctgctcgccggcctc
gcgcgcgaaccgcgctgggacgtgatcgtcatcggtggcggcgccaccggcctgggcacg
gccgtcgacgcagcctcgcgcggctaccgcacgctgctggtcgaggccgcggacttcgcc
aaaggcacctccagcaaggccaccaagctcgtgcacgggggcgtgcgctacctcgcgcag
ggcaatatcagcctggtgcgtgaggccttgcacgaacgcggcctgctggcccgcaacgca
ccgcacctggtgtggccgctcggcttcgtcgtgccggcctaccagatgctggaccagccc
ttctacggcatcggcctcaaggtctacgacatgctcgcgggcaacctcaagctggccggc
agccgctggctgaaccaccgcgagacgctggccgccgcgcccacgctcgccgaacacgtg
ggcggacgcccgctgcgcggcggcaacctgtacttcgacggccagttcgacgacgcacgg
ctggcgatcgccctgatgcgcaccctcttcgacgtgggcggcaccgcggtcaactacctg
cgcgtgaccggcctgctgcagcaaggcggcgccgtcaccggcgtcaccgtgcaggacgcg
ctcggcgaggcctgcttcgccctgcaggcgaagtgcgtgatcaacgccaccggcgtctgg
gtggatgccgtgcgccgcatggaggacggccaggcccgcaccatggtggcgcccagccag
ggcgtgcacctgacgctgccgcgcagcttcctgcccggccaggacgccatcctgatcccg
cgcaccgacgacggccgggtactgttcgtggtgccctggaacggccacaccatcgtcggc
accaccgacaccccgcgccaggacctgccgctcgaaccgcgcgccgccggcgacgacgtc
gacttcatcctggaaacggcggcgcgctacctgtcccgctcgcccactcgcgccgacgtc
accagcgtctgggccgggctgcgcccgctggtcaaggcgaccggggaaaacaccaccgca
tcgctgtcgcgcgagcacaccatcctggtctccaagggcggcctgatcaccgtgaccggc
ggcaagtggaccacctatcgcaagatggcggaggacgtggtggacaccgccatccagcgc
gggctggtggcgcgcgctgcgccctgcatcacgacggaactggcgttgcatggcgcacag
ggcctgccggccgacctgccggcatccggcagcggctcacccgatcgctattacggcaac
gaattgggagccttgcgcgcactgcctggccaggacgaggtgctgatggcgggctccggg
ctgaccgccgcccacgtccgcttcgccgcgcgccacgaaatggcgcggcgcgtcgaggac
gtgctggcgcgccgcaatcgcgccctgttcctcgatgcgcgtggcgccagcgcggccgcg
ccgcgcgtggcggccatcctggccgaggaactgcagcacgatgctgcctggcaaacccgc
gaagtggaggacttccgcaagctcgcctcgggttatatgctcgactga

DBGET integrated database retrieval system