KEGG   Cupriavidus sp. USMAA2-4: BKK79_20960Help
Entry
BKK79_20960       CDS       T05072                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00500  Starch and sucrose metabolism
cuu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cuu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BKK79_20960
Enzymes [BR:cuu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BKK79_20960
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BKK79_20960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: AOY94424
UniProt: A0A1D9H3Q6
LinkDB All DBs
Position
2:175500..178871
Genome map
AA seq 1123 aa AA seqDB search
MKRLSERAHSALLNADPLWYKDAVIYQLHIKSFFDGNGDGVGDFSGLLAKLDYLVDLGVD
TVWLLPFYPSPRLDDGYDIADYRNVHPEYGTLSEARRFIHAAHAHGIRVITELVINHTSD
QHPWFQRSRRAKPGSAARNYYVWSDDDQAYAGTRIIFCDTEKSNWSWDPVAGAYFWHRFY
AHQPDLNFDNPHVLSEVLSVMRFWLDIGVDGLRLDAVPYLVEREGTSNENLPETHAIIRK
IRAHLDARYPGRMLLAEANMWPEDAQQYFGIDGAAADGRGEECHMAFHFPLMPRMYMAIA
REDRFPITDIMRQTPEVPVDCQWAIFLRNHDELTLEMVTSSERDYLWEVYASERRARINL
GIRRRLAPLMERDRRRIELMNSLLFSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQWS
PDRNGGFSRADPERLVLPPLQGPLYGYEAVNVEAQERDPHSLLNWMRRMLALRRKHRAFG
RGTLRFLFPGNRKILAYLREYDDVHILCVANLSRAPQAVELDLSAFNGRVPVEMMGATPF
PAIGTLTYLLTLPPYGFYWFVLSDEAQPPPWHMETPEQMPDQVTLVLQNRGRPELTEASR
RLLDEEVLPPYLRRRRWFGAKGETIRRASLAYMLPFARGDGGEETWLGEVEVVLAGGRTE
RYQLPVGLLWDRDNPDGIPPLAHGLSMARVRQGSRVGLATDGFTSELFAREIVQALRAGS
ELRGPQETIRFKAEPGLAAMHPEREEIQWMSAEQSNSSLAYGNTAVLKLVRRLSGGCHPE
VEVTRYLTSQGYPHCAPLLGEAVRIGADGEPHTLMLLQGYIPNQGNGWDWTLDYLARAID
DALPAKESEDEFIEAMSGYAAMATTLGRRLAELHEVLARSSEDPAFAPEPAGAAKSEQWA
RQALARLTHALDLLEICPIDTSQPAQERLGEDVQLLLQARQALPALVERLAAAAPGGLQT
RIHGDFHLGQVLIAQNDAYLVDFEGEPGQPLAWRRRKTSPLRDVAGLLRSLDYAAATVGT
DRQERTHAELPPALAQRRGELLERFRATATEAVLGGYREHLEACATPWVQAGQLQPLLDL
FLLERAAYEVEYEAANRVAWIDLPASGLARLVGQLLADDTEAR
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctcagcgaacgtgcacatagcgccctgctgaacgccgacccgctttggtac
aaggacgccgtgatctaccagttgcacatcaagtccttcttcgatggcaacggcgacggc
gtgggcgatttctcgggcctgctggccaagctggactacctggtcgacctcggcgtcgac
accgtctggctgctgccgttctacccttcgccccgcctcgacgacggctacgacatcgcg
gactaccgcaatgtgcatccggagtacggcacgctgtccgaagcgcggcgcttcatccat
gccgcgcacgcgcacggcatccgcgtcatcaccgaactggtcatcaaccacacctccgac
cagcacccctggttccagcgctcgcgcagggccaaacccggctcggcggcccgcaactac
tatgtgtggtccgacgacgaccaggcctacgccggcacgcgcatcatcttctgcgacacc
gagaagtccaactggagctgggacccggtggccggcgcctacttctggcaccgcttctat
gcgcaccagcccgacctgaacttcgacaatccgcacgtgctcagcgaggtgctgtccgtc
atgcgcttctggctcgacatcggcgtggacgggctgcggctggacgcggtgccctacctg
gtggaacgcgaaggcaccagcaacgagaacctgccggagacccacgccatcatccgcaag
atccgcgcccacctcgacgcgcgctatccgggccgcatgctgctggccgaagccaatatg
tggccggaagacgcgcagcagtacttcggcatcgacggcgcggccgcggacggcaggggc
gaggaatgccacatggccttccacttcccgctgatgccgcgcatgtacatggccatcgcg
cgcgaagaccgcttcccgatcaccgacatcatgcgccagaccccggaagtcccggtcgac
tgccagtgggccatcttcctgcgcaaccacgatgagctgacgctcgagatggtcaccagc
agcgagcgcgactacctgtgggaggtctacgcgtccgagcggcgcgcccgcatcaatctc
ggcatccgccggcggctggcgccgctgatggaacgcgaccgtcgccgcatcgagctgatg
aacagcctgctgttctccatgccgggcaccccggtcatctactacggtgacgagatcggc
atgggcgacaacatccacctgggcgaccgggacggcgtgcgcacgccgatgcagtggtcg
cccgaccgcaacggcggcttctcgcgcgccgacccggaacggctggtactgccgccgctg
caggggccgctgtacggctatgaagcggtcaacgtggaagcgcaggaacgcgacccgcat
tcgctgctgaactggatgcggcggatgctggcgctgcgccgcaagcaccgcgccttcggc
cggggcacgctgcgcttcctgtttccgggcaaccgcaagatcctggcctacctgcgtgag
tacgacgacgtgcacatcctgtgcgtggccaatctctcgcgcgccccgcaggcggtggag
ctggacctgtccgccttcaatggccgggtccccgtggagatgatgggcgccacgcccttc
cccgccatcggcacgctgacttacctgctcaccttgcctccctatggcttctactggttc
gtgctgagcgatgaggcacagccgccgccctggcacatggagactcccgaacagatgccc
gaccaggtcacgctcgtgctgcagaacagggggcgcccggagttgaccgaagcgtcccgg
cgcctgctcgacgaggaagtactgcccccctaccttcgccgccgccgctggttcggcgcg
aagggcgagaccatccgccgcgcatcgctggcctatatgctgcctttcgcgcgcggcgac
ggtggcgaggagacctggctcggtgaagtggaggtggtcctggccggcgggcgcaccgag
cgctaccagctcccggtgggcctgctgtgggaccgcgacaaccccgacgggataccgccg
ctcgcccacggcctgtcgatggcgcgcgtgcggcagggcagccgggtcgggctggccacc
gacggcttcacctcggaactgttcgcgcgcgagatcgtgcaggccctgcgtgccggcagc
gaactgcgcggcccgcaggaaaccatccgcttcaaggccgagcctggattggcggccatg
caccccgagcgggaagagatccagtggatgtcggccgagcaatccaacagctcgctcgcc
tacggcaacacggcggtgctgaagctggtccgccggctgtccggcgggtgccaccccgag
gtcgaagtgacacgctacctgaccagccagggctacccgcattgcgccccgctgctgggc
gaagcggtgcgcatcggcgccgatggcgagccacacacgctgatgctgctgcaaggctac
atccccaaccagggcaacggctgggactggaccctggactacctggcccgcgcgatcgac
gatgccttgccggcgaaggaaagcgaggacgaattcatcgaggccatgtccggctatgcc
gccatggccaccaccctgggccgcaggctggccgaactgcacgaggtgctggcacgctcc
agcgaggaccccgcctttgcccccgagcccgccggcgcggccaagagcgagcagtgggca
cggcaggccctggcccggctcacgcacgccctggacctgctggagatctgccccatcgat
acttcgcagcccgcgcaggagcggctcggcgaggatgtgcagttgctgctgcaggcacgc
caggccttgcccgcgctggtcgagcggctcgccgccgcggcgcccggcggcctgcagacc
cgtatccacggggattttcacctgggccaggtgctgatcgcgcagaacgacgcctacctg
gtggacttcgagggcgagcccggccagccgctggcctggcgccggcgcaagacctcgccg
ctgcgggatgtcgccggcctgctgcgctcgctcgactatgccgcagccaccgtcggcacc
gaccggcaggagcgcacccatgccgaactgccccccgcgctggcgcaacgccgcggagaa
ctgctggagcgcttccgcgccaccgccacggaggccgtcctcggcggctatcgcgagcac
ctcgaagcctgcgctacgccatgggtgcaggccgggcagctccagccgctgctggacctg
ttcctgctggaaagggccgcctacgaagtcgagtacgaggcggccaatcgcgtggcatgg
atcgacctgcccgccagcggcctggcaaggctggtgggccagctgctggcggacgacacg
gaggcccgatga

DBGET integrated database retrieval system