KEGG   Cupriavidus sp. USMAA2-4: BKK79_25720Help
Entry
BKK79_25720       CDS       T05072                                 

Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00250  Alanine, aspartate and glutamate metabolism
cuu00280  Valine, leucine and isoleucine degradation
cuu00410  beta-Alanine metabolism
cuu00640  Propanoate metabolism
cuu00650  Butanoate metabolism
cuu01100  Metabolic pathways
cuu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BKK79_25720
   00650 Butanoate metabolism
    BKK79_25720
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BKK79_25720
   00280 Valine, leucine and isoleucine degradation
    BKK79_25720
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BKK79_25720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cuu01007]
    BKK79_25720
Enzymes [BR:cuu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BKK79_25720
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BKK79_25720
Amino acid related enzymes [BR:cuu01007]
 Aminotransferase (transaminase)
  Class III
   BKK79_25720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOY95194
UniProt: A0A1D9H603
LinkDB All DBs
Position
2:1276290..1277552
Genome map
AA seq 420 aa AA seqDB search
MKNAELVRRKDAATPRGVGVMCNFYAERADNAEIWDVEGKRYIDFAAGIAVLNTGHRHPR
LVQAIERQLARFTHTAYQIVPYASYVELAEKINARAPGRFAKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVVPYKVGFGPFPGEVYHAPYPCELHGVTVE
DSLKSLQHLFKADVDPRRVAAIIFEPVQGEGGFNVAPPAFVEALRALCDEHGILLVADEV
QTGFGRTGKLFAMEHYGVVPDLTTMAKSLAGGMPLSAVCGRAEVMDAPAPGGLGGTYAGN
PLAVASALAVLDVLEAEQLPARGALLGERLVARLQALQPRVPQIAEVRGLGAMVAVEFRQ
ADGSPDAAFTREVQNRALERGLLLLSCGVYGNVIRFLFPLTIPDGVMEEGLDILADVLTR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgccgaactggtccgccgcaaggacgccgccaccccgcgcggcgtcggcgtg
atgtgcaatttctacgccgagcgggccgacaatgccgagatctgggacgtcgaaggcaag
cgctacatcgacttcgccgccggtatcgccgtgctgaacacgggccaccgccacccgcgc
ctggtgcaggccatcgagcgccagctcgcgcgcttcacccataccgcctaccagatcgtg
ccctacgccagctacgtggagctggccgagaagatcaatgcgcgcgcgcccggccgcttc
gccaagaagacggccttcttcaccaccggcgcggaggccgtggagaacgccatcaagatc
gcccgcgcggccaccggccggcccggcgtgatcgccttttcgggcggcttccacggccgc
accatgatgggcatggcgctgaccggcaaggtggtgccctacaaggtgggcttcggcccc
ttcccgggcgaggtctatcacgcgccctatccctgcgaactgcatggcgtcacggtggag
gactcgctcaagagcctgcagcacctgttcaaggccgacgtcgatccgcgccgcgtggcg
gccatcatcttcgagccggtgcagggcgagggcggcttcaacgtggccccgcccgccttc
gtcgaagcgctgcgcgccctctgcgacgagcacggcatcctgctggtcgccgacgaggtg
cagaccggtttcggccgcaccggcaagctgttcgccatggagcactacggcgtggtgccg
gacctcaccaccatggccaagagcctggccggcggcatgccgctgtcggccgtgtgcggc
cgcgccgaggtgatggacgcgccggcgcccggcggcctgggcggcacttatgcgggcaac
ccgctggcggtggcctcggcgctggccgtgctggacgtgctggaagccgaacagctgccg
gcacgcggcgcgctgctgggcgagcggctggtggcgcggctgcaggccctgcagccgcgc
gtgccgcagatcgccgaagtgcgcggcctcggcgccatggtggcggtcgagttccgccag
gccgacggcagcccggacgcggccttcacgcgcgaggtgcagaaccgcgcgctggagcgc
ggcctgctgctgctgtcgtgcggcgtgtacggcaatgtgatccgcttcctgttcccgctc
accattcccgacggagtgatggaggaaggactggatatcctggccgacgtgctgacgcgc
tga

DBGET integrated database retrieval system