KEGG   Cupriavidus sp. USMAA2-4: BKK79_27645Help
Entry
BKK79_27645       CDS       T05072                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00550  Peptidoglycan biosynthesis
cuu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKK79_27645
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BKK79_27645
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
    BKK79_27645
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cuu03036]
    BKK79_27645
Enzymes [BR:cuu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BKK79_27645
Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BKK79_27645
Chromosome and associated proteins [BR:cuu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BKK79_27645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AOY95527
UniProt: A0A1D9H6P5
LinkDB All DBs
Position
2:complement(1690912..1692720)
Genome map
AA seq 602 aa AA seqDB search
MHRNRPNRNVKFSASPVLQTRTSLWRSKLVVGFITLAFGGLVARAFWIAGPGNSFFIAQG
EKRYEHAIVMPAVRGKIEDRDGHVLATSLPMRTIWAVPAEVPADLPDQQLAQAGKLLEMP
VRELRSKLIGERKFVYVKRQVSPEVGKQIEALGIPGVYESSEYKRFYPEGEVTAHVVGFT
NVEDKGQEGMELGEETQLEGRSGVRHVIKDRIGHTIEDLDDSTPARVGADVRLTLDTRVQ
YVAYQALKNALERTGAKAGMAVVIDVKAGQVLALANLPTYNPNDREHLTGEQLRNRVFTD
VFEPGSILKPFTMALALDLHRLTPATLIDTGPGRYVFEGATITDDSANGVLTAAGVIQKS
SNIGMTKVSTMLHAEEMWDMFTEIGLGQAPKLGFPGAVTGRVRPFKKWRPIEQATMAYGY
GISASLFQLARAYTIFANDGMLAPITILQGDPAAQTKGVRVIDSKTAAEMRQMLAGVVSV
GGTATTAQVDGYSIGGKTGTAYKAGAHGYDHSKYRASFVGLAPLSAPRLVIAVSIDEPKA
SQHFGGQAAGPAFAEIASQALPLLGIRPDLPFKPGAILAAPTDMPQDNLPAGKPGGPLGG
HA
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaaccgcccgaacaggaacgtcaagttctcagccagccccgtgctgcagacc
cgtacatcgctctggcgctccaagctggtggtcggcttcatcaccctcgccttcggcgga
ctggtcgcccgcgccttctggatcgccggccccggcaacagcttcttcatcgcccagggc
gaaaagcgctacgagcacgccatcgtgatgcccgccgtgcgcggcaagatcgaggaccgc
gacggccacgtgctggccaccagcctgcccatgcgcaccatctgggcggtgccggccgaa
gtccccgccgacctgcccgaccagcagctggcccaggccggcaagctgctcgagatgccg
gtgcgcgagctgcgcagcaagctgatcggcgagcgcaagttcgtctacgtcaagcgccag
gtctcgcccgaggtcggcaagcagatcgaggcgctcggcattcccggcgtctacgaaagc
agcgagtacaagcgcttctaccccgaaggcgaagtgaccgcccacgtggtcggcttcacc
aatgtcgaggacaagggccaggaaggcatggaactgggcgaggaaacccagctcgaaggc
cgctcgggcgtgcgccacgtcatcaaggaccgcatcggccacaccatcgaggacctggac
gattccacgccggcgcgcgtgggcgccgacgtccgcctgacgctcgacacgcgcgtgcag
tacgtcgcttaccaggcgctgaagaacgcgctggagcgcaccggcgccaaggccggcatg
gcggtggtgatcgacgtcaaggccggccaggtgctggcgctggccaacctgcccacctac
aaccccaacgaccgcgagcacctgaccggcgagcagctgcgcaaccgcgtcttcaccgat
gtgttcgagccgggctccatcctcaagcccttcaccatggcgctggcgctggacctgcac
cgcctcacgcctgccaccctgatcgacaccggcccgggccgctacgtgttcgagggcgcc
accatcaccgacgacagcgccaacggcgtgctgacggcggccggcgtgatccagaagtcc
agcaatatcggcatgaccaaggtctcgacgatgctgcacgccgaagagatgtgggacatg
ttcaccgagatcggcctgggccaggcgcccaagctcggcttccccggcgcggtcaccggc
cgcgtgcggccgttcaagaaatggcgccccatcgaacaggccaccatggcctacggctac
ggcatctcggcctcgctgttccagctcgcgcgcgcctacaccatcttcgccaacgacggc
atgctggccccgatcaccatcctccagggcgaccccgccgcgcaaaccaagggcgtgcgc
gtgatcgacagcaagaccgccgccgagatgcgccagatgctggccggcgtggtcagcgtg
ggcggcaccgccaccaccgcccaggtcgacggctacagcatcggcggcaagaccggcacc
gcctacaaggccggcgcccacggctacgaccactccaagtaccgcgcctccttcgtcggc
ctcgcgccgctgtccgcgccgcgcctggtgatcgccgtgtccatcgacgaacccaaggcc
tcgcagcacttcggcggccaggccgccggcccggccttcgccgagatcgcctcgcaggcg
ctgccgctgctgggcatccgtcccgacctgccgttcaagcccggcgccatcctggcggcg
ccgaccgacatgccgcaggacaacctgccggccggcaagcccggcgggccgctgggcggc
cacgcctga

DBGET integrated database retrieval system