KEGG   Cupriavidus sp. USMAA2-4: BKK79_30890Help
Entry
BKK79_30890       CDS       T05072                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00550  Peptidoglycan biosynthesis
cuu01100  Metabolic pathways
cuu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cuu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BKK79_30890
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BKK79_30890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cuu01003]
    BKK79_30890
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
    BKK79_30890
Enzymes [BR:cuu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     BKK79_30890
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BKK79_30890
Glycosyltransferases [BR:cuu01003]
 Polysaccharide
  Bacterial polysaccharide
   BKK79_30890
Peptidoglycan biosynthesis and degradation proteins [BR:cuu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   BKK79_30890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AOY96054
UniProt: A0A1D9H8E1
LinkDB All DBs
Position
2:2476779..2479238
Genome map
AA seq 819 aa AA seqDB search
MTPAQIKTFFAARLQRLRRPTRRELALGIAAVPALFLLYVLVLIPFTPGISDIRKAKQDR
PAQILSADGKELALFKWANREWVPLDEISPEVVKALVATEDHRFYQHHGIDWRRLASAAL
RTASGDRQGGSTITQQLARNLYPDEIGRAPTLTRKLKEAITALKIEALYSKNEILETYLN
TVPFLYNAFGIEMAARTYFGKSADKLDVLESATLIGMLKGNSYYNPVINPERSLQRRNTV
LAQMVKRGVLDPARYAQLQKRPLRIDFERQDEEPGPAPHFAQQLRKWLIGWADRNDYNIY
TDGLVVRTTIDSRLQAFANQALARQTRQLQGIADAAWNGRTGWRPEQELVRAFVRETPQY
RAARDAGASADDALKHLLADRAFMQDLRQQKTMIQAGFIAIDPRDGAIKAWVGSRDFALD
AFDHVQQARRQPGSTFKPFVYGAAFAQGARPEDTYPDQAVSIPMPGGEVWSPSDESPPTG
MPISLRDALAQSRNRITAQLMQSVGPDQVARLARAMGVRQSPLEAVPSLALGTSPVSLKE
MVSAYATIADGGEYIAPMMVTRIEDAKGEVLAEFQPARAERALSFDATQTLLDVMRGVVD
RGTGTAIRTRFGIRADVAGKTGTTQDNADGWFILMHPELVAGAWVGFNDSRVTLRSDYWG
QGAHSALPIVGDVFQRALRTRLVDARVRFPEEQEPGLFGAWFAKLRERLRQLFAPAPAPE
AAAPRAARPARSAPAETPVQAASEAASAPVAGPAPAPASDAAAADAGQPGPAAGAIAASA
AAAAPPQAPPAVTTVPPPGAGATMPAPAGTPASAPASML
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgactccggcccagatcaagacctttttcgccgcccggctgcagcgcctgcggcgtccc
acccgccgtgaactggccctgggcatcgccgccgtgccggcgctgttcctgctctatgtg
ctggtgctgatcccgttcacgccgggcatcagcgacatccgcaaggccaagcaggaccgg
cccgcgcagatcctgtcggcggatggcaaggagctggcgctgttcaagtgggccaatcgc
gaatgggtgccgctcgacgagatctcgcccgaggtggtcaaggccctggtcgccaccgag
gaccaccgcttctaccagcaccacggcatcgactggcgccgcctcgcctcggccgccctg
cgcaccgcctcgggcgaccgccagggtggctccaccatcacccagcagctggcccgcaat
ctctatccggacgagatcgggcgcgcgccgacgctgacgcgcaagctcaaggaagccatc
accgcgctcaagatcgaggcgctgtacagcaagaacgagatcctcgagacctacctgaac
acggtccccttcctgtacaacgccttcggcatcgagatggcggcgcgcacctatttcggc
aagtcggccgacaagctcgacgtgctggagagcgccacgctgatcggcatgctcaagggc
aacagctactacaacccggtgatcaaccccgagcgctcgctgcagcggcgcaacacggtg
ctggcgcagatggtcaagcgcggcgtgctggacccggccaggtatgcgcaactgcagaag
cgcccgctgcgcatcgacttcgagcgccaggacgaggagcccggcccggcgccccatttc
gcccagcagctgcgcaagtggctgatcggctgggccgaccgcaacgactacaacatctac
accgacggcctggtggtgcgcaccaccatcgactcgcgcctgcaggccttcgccaaccag
gcgctggcgcgccagacgcgccagctgcagggcatcgccgacgcggcctggaacggccgc
accggctggcgtcccgagcaggagctggtgcgcgccttcgtgcgcgagacgccgcagtac
cgcgccgcgcgcgacgccggcgccagcgccgacgatgcgctcaagcacctgctggccgac
cgcgccttcatgcaggacctgcgccagcagaagaccatgatccaggccggcttcatcgcc
atcgatccgcgcgacggcgccatcaaggcctgggtgggcagccgcgacttcgccctcgac
gccttcgaccatgtccagcaggcgcggcgccagcccggctccaccttcaagcccttcgtc
tacggcgcagccttcgcccagggcgcgcggccggaggacacctatcccgaccaggcggtg
tccatccccatgcccggcggcgaggtctggagcccgagcgacgagtcgccgcccaccggc
atgccgatctccctgcgcgatgccctggcgcagtcgcgcaaccgcatcaccgcgcaattg
atgcagagcgtcggccccgaccaggtggcgcggctggcgcgcgccatgggcgtgcgccag
agcccgctggaagcggtgccgtcgctggcgctgggcaccagtccggtgagcctcaaggag
atggtgtcggcctatgccaccatcgccgacggcggcgagtacatcgcgccgatgatggtg
acccgtatcgaggacgccaagggcgaggtgctggccgaattccagccggcgcgcgcggag
cgggcgctgtccttcgatgccacgcagaccctgctcgacgtcatgcgcggcgtggtcgac
cgtggcaccggtaccgccatccgtacgcgcttcggcatccgtgccgacgtggccggcaag
accggcaccacgcaggacaatgccgacggctggttcatcctgatgcatcccgaactggtg
gcgggggcctgggtcggcttcaacgacagccgcgtgacgctgcgcagcgactactggggg
cagggcgcgcacagcgcgctgcccatcgtcggcgatgtcttccagcgcgcgttgcgcacg
cgcctggtcgacgcccgcgtgcgcttccccgaggagcaggagcccggcttgttcggcgcc
tggttcgccaagctgcgcgagcgcctgcgccagctgttcgcgccggccccggcgcccgag
gcagccgcgccacgcgcggcgcggccagcgcgcagcgcgccggccgaaacgccggtccag
gccgccagcgaggccgcttcggcgcccgttgccgggccggcgccggcgccggcatccgat
gccgcggccgccgatgccggccagccgggcccggcggccggtgccatcgcggcaagtgcc
gccgccgccgcgccgccccaggcgccgcctgccgtgaccaccgtaccgccgccgggcgcg
ggcgccaccatgccggcgccggcggggacgccggcatcggctccggcttcgatgctctag

DBGET integrated database retrieval system