KEGG   Cupriavidus sp. USMAA2-4: BKK79_34010Help
Entry
BKK79_34010       CDS       T05072                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cuu  Cupriavidus sp. USMAA2-4
Pathway
cuu00010  Glycolysis / Gluconeogenesis
cuu00620  Pyruvate metabolism
cuu01100  Metabolic pathways
cuu01110  Biosynthesis of secondary metabolites
cuu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BKK79_34010
   00620 Pyruvate metabolism
    BKK79_34010
Enzymes [BR:cuu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BKK79_34010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AOY96554
UniProt: A0A1D9H9U1
LinkDB All DBs
Position
2:3216746..3218266
Genome map
AA seq 506 aa AA seqDB search
MNHAEMKFLDIEFPYKDRYDNYIGGKWVPPRSGQYFDNISPVTGEVFCQIARSNADDVEL
ALDAAHAAKTAWGRTSPAERANVLNRIADRMEANLKRLAVAETIDNGKPLRETMAADLPL
AVDHFRYFAGTVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMEIIGDLLPPGVLNVVSGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESVYDRFMERAIKRVEAIKQGHPLDPSTMIGAQASQEQLEKILSYIDLGK
QEGAQLLAGGARNQLGGALDKGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDVNRAYRFGREIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgccgaaatgaagttcctcgacatcgaattcccgtacaaggaccgctacgac
aactacatcggcggcaagtgggtgcccccgcgctcgggccagtacttcgacaacatctcg
ccggtgaccggcgaagtcttctgccagatcgcgcgctccaacgccgacgacgtggaactg
gcgctggacgccgcgcacgccgccaagaccgcctggggccgtacctcgccggccgagcgc
gccaatgtcctcaaccgcatcgccgaccgcatggaggccaacctcaagcgcctggccgtg
gccgagaccatcgacaacggcaagccgctgcgcgagaccatggcggccgacctgccgctc
gcggtcgaccacttccgctacttcgccggcaccgtgcgcgcccaggaaggcggcatctcc
gagatcgaccacgacaccatcgcctatcacttccatgagccgctgggcgtggtcggccag
atcatcccgtggaacttcccgctgctgatggccacctggaagctggccccggcgctggcc
gccggcaactgcgtggtgctcaagccggccgagcagaccccggcctcgatcctggtgctg
atggagatcatcggcgacctgctgccgccgggcgtgctcaacgtggtgagcggcttcggc
ctcgaggccggcaagccgctggcgtcgaacaagcgcatcgccaagatcgccttcaccggt
gagaccaccaccgggcggctgatcatgcagtacgcctcgcagaacctgatcccggtcacg
ctggagctgggcggcaagagccccaacatcttcttcgccgacgtgctcgacaaggacgac
gccttcttcgacaaggcgctggaaggcttcgccatgttcgcgctgaaccagggcgaggtc
tgcacctgcccgtcgcgcgccctgatccaggaatcggtctacgaccgcttcatggagcgc
gccatcaagcgcgtcgaggccatcaagcagggccacccgctcgacccctccaccatgatc
ggcgcgcaggcctcgcaggagcagctcgagaagatcctctcctacatcgacctgggcaag
caggaaggcgcgcagctgctggcgggcggcgcgcgcaaccagctcggcggcgcgctcgac
aagggctactacgtcaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtggtatcggtgaccaccttcaagaccgaagaggaagcgctg
gaaatcgccaacgacaccctgtacgggctgggcgccggcgtatggacgcgcgacgtcaac
cgcgcctaccgcttcggccgcgagatccaggccggccgcgtgtggaccaactgctaccac
gcctacccggcccacgcggccttcggcggctacaagcagtcgggcatcgggcgcgagaac
cacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctacagcccg
aacgcgctcggcttcttctga

DBGET integrated database retrieval system