KEGG   Corynebacterium ureicelerivorans: CUREI_01525Help
Entry
CUREI_01525       CDS       T03241                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cuv  Corynebacterium ureicelerivorans
Brite
Translation factors [BR:cuv03012]
 Eukaryotic Type
  Elongation factors
   CUREI_01525
 Prokaryotic Type
   CUREI_01525
Mitochondrial biogenesis [BR:cuv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CUREI_01525
Exosome [BR:cuv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CUREI_01525
  Exosomal proteins of breast cancer cells
   CUREI_01525
  Exosomal proteins of colorectal cancer cells
   CUREI_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIL96166
UniProt: A0A077HIC6
LinkDB All DBs
Position
293424..294614
Genome map
AA seq 396 aa AA seqDB search
MSKEKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPEENKAFAFDAIDKAPEERE
RGITINISHVEYNTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIVHISALKAL
EGEEKWVQSVLDLMQACDDSIPDPERETDKPFLMPIEDIFTISGRGTVVTGRVERGVLNL
NDEVEIIGIREKSQKTTVTSIEMFNKLLDTAEAGDNAALLLRGLKREDVERGQVIIAPGA
YTPHSKFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVE
MTVELIQPVAMDEGLRFAIREGSRTVGAGRVTKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgtctaaggaaaagttcgagcgcactaagccgcacgtgaacatcggtaccatcggtcac
gtcgaccacggcaagaccaccaccaccgctgctatcaccaaggtgctggctgacgcgtac
ccggaggagaacaaggcattcgccttcgacgccatcgataaggctccggaggagcgcgag
cgcggcattaccatcaacatctcccacgtggagtacaacaccccgaagcgccactacgct
cacgtggacgccccgggccacgccgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgcgatcctggtggttgctgctaccgacggcccgatgccgcagacccgcgag
cacgtgctgctggctcgccaggttggcgttccgtacatcctcgttgcgctgaacaagtgc
gacatggtcgacgacgaggagatcatcgagctcgtcgagatggaggtccgcgagctgctg
gctgagcaggactacgacgaggacgctccgatcgttcacatctccgctctgaaggctctt
gagggcgaggagaagtgggttcagtctgtgctggacctcatgcaggcttgcgacgattcc
atcccggatccggagcgcgagaccgacaagccgttcctgatgccgatcgaggacatcttc
accatttccggccgcggcaccgtggtgaccggtcgtgtggagcgcggcgtgctcaacctc
aacgacgaggtcgagatcatcggtatccgtgagaagtcccagaagaccaccgtcacctcc
atcgagatgttcaacaagcttctcgacaccgctgaggccggcgacaacgccgctctgctg
ctccgtggtctgaagcgcgaggacgtcgagcgtggccaggtcatcatcgcaccgggcgct
tacaccccgcactccaagttcgagggttccgtctacgtcctgtccaaggacgagggcggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtg
accggtgttgtgaagctgccggagggcaccgagatggtcatgccgggcgacaacgtcgag
atgaccgtcgagctgatccagccggtcgccatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggcgctggccgcgttaccaagatcctggactaa

DBGET integrated database retrieval system