KEGG   Corynebacterium ureicelerivorans: CUREI_07985Help
Entry
CUREI_07985       CDS       T03241                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cuv  Corynebacterium ureicelerivorans
Brite
KEGG Orthology (KO) [BR:cuv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cuv01001]
    CUREI_07985
Enzymes [BR:cuv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CUREI_07985
Protein kinases [BR:cuv01001]
 Serine/threonine kinases: Other
  Bacterial family
   CUREI_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like RIO1 Pkinase_fungal Kdo Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AIL97242
UniProt: A0A077HRC7
LinkDB All DBs
Position
1581627..1582895
Genome map
AA seq 422 aa AA seqDB search
MATLGAGTTLDGRYVVDRPIARGGMATVYRCVDRRLGREVAAKVMHEQYVHDEVFRERFR
REARAMAQLSHPNLVNVYDFSASGDEVFLVMELITGGTLRELLAERGPMPPHAAAAVMRG
MLTGLAVAHEKGMVHRDIKPDNVLIDASSRVKLSDFGLVRATAETTQSTDQIVGTVAYLS
PEQVDGSPTTAASDVYSAGIVLFELLTGQTPFDGDTPLAHAYARLRSDVPAPSTLIAGVP
KLFDELVATATSRNPADRFHDAADFLAALDDVSRELRLPAYTVPAPRNSAAHRATEHPTN
FGLAAADPSIPPAEAAPTVARQRLFPGDDAPTRVSAPAPSRDQWPAAAAVPPPVVAPQAP
VERVPAPAPQRPTVNPVSNRSPIGVAIYMVLALGVVVAIGLGAWWFGSGMYGEIPEIIVP
LF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggctaccttgggtgcaggcacgacattggacggacgttacgtcgtcgaccgcccaatc
gcgcgtggggggatggccaccgtctaccggtgcgtggacaggcgcttgggccgcgaagtg
gcggcgaaggtgatgcacgagcagtacgtccacgacgaggtgttccgcgaacgcttccga
cgagaggctcgcgcgatggcgcagctcagccacccgaacctggtcaatgtctacgacttc
tccgcctcgggcgacgaggtttttctggtcatggagctgatcaccgggggcacgctgcgc
gaactcctcgccgagcgcggtcccatgccgccgcacgccgcggcagcggtgatgcgcggc
atgctcaccggcctagcagtcgcgcacgagaaagggatggtccaccgcgacatcaagccc
gacaatgtgctcatcgacgcatccagtcgcgtcaaactctccgacttcggcttggtgcgc
gccactgcggaaaccacccaatccaccgaccagatcgtgggcacagtcgcctacctgtcc
cccgaacaggtcgacggcagccccaccaccgccgcatccgacgtgtactccgcaggcatc
gtgctcttcgaacttctcacggggcaaacacccttcgacggcgacacaccccttgcgcac
gcgtacgcaaggctgcggtcggacgtgccggcgccgtccacgctcatcgccggggtgccg
aagcttttcgacgagctggtggccaccgccacctcccgaaacccggctgacaggttccac
gacgcggccgatttcctcgctgcgctcgacgacgtgtcccgcgagctgcgcctacccgcc
tacacggtgcctgcgccccgaaactcggccgcgcaccgtgccaccgaacatccgacgaat
ttcgggctcgccgctgctgacccttcgattcccccagcggaagctgccccgactgtcgcc
cgtcagcgtctgtttccgggcgatgacgccccgacgcgcgtctccgcgcccgccccctcc
cgcgaccagtggcctgctgcggccgcggtgccaccccccgtggtggcgccgcaagcaccg
gtggagcgggtgccggcgcccgcacctcagcgacccaccgtcaacccggtgtcgaaccgt
tccccgatcggcgtagccatctacatggttttggccctcggcgtcgtcgtggccatcggg
ctgggcgcgtggtggtttggctcggggatgtacggcgaaatccccgagatcatcgtcccc
ctgttctaa

DBGET integrated database retrieval system