KEGG   Corynebacterium ureicelerivorans: CUREI_08600Help
Entry
CUREI_08600       CDS       T03241                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cuv  Corynebacterium ureicelerivorans
Pathway
cuv00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cuv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CUREI_08600
Enzymes [BR:cuv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CUREI_08600
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CUREI_08600
    1.1.1.-  
     CUREI_08600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C ADH_N_assoc 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIL97342
UniProt: A0A077HRS0
LinkDB All DBs
Position
complement(1701448..1702512)
Genome map
AA seq 354 aa AA seqDB search
MRAVRYYGQKDIRVEEIDAPVAGEGEVLIDIAWCGICGTDLHEYLEGPIFCPAPGHPHPI
TGEEPPVTLGHEFSGVVAALGEGVDDLEVGQHVVVEPYVLPDDVDPKEPGPYNLHPDVNF
IGLAGGGGGLSEKVAVQRRWVHPINNDVPLDEAALIEPLSVAHHAFVASEAKEGDVALIG
GAGPIGVLTAAVAKAYGCTVIVSELSELRRRKAIDAGVADHAIDPSKQDLKEEILKLTDG
KGVDVAFEATSVNVVLDQLIDCLKLKGTLVVESIWSKKAQFDIHALVMKELTVRGIIGYA
HDHEQTIKLVEDGKVDLKPFITGKIGFDGVVDEGFDTLINRNETAVKILVSPEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctgtgcgctactacggccagaaagacatccgcgtcgaggaaatcgacgccccg
gttgcaggcgaaggcgaggtgctcatcgacatcgcctggtgcggcatctgcggcaccgac
ctgcacgaatacctcgagggcccgatcttctgcccggcacccggccacccgcacccgatc
accggggaggaaccgccggtcaccctcggccacgagttctccggcgtcgtcgccgcgctc
ggcgagggcgtggacgacctcgaggtcggccagcacgtcgtcgtcgagccatacgtgctg
ccggatgacgttgatccgaaggagccgggcccgtacaacctgcacccggacgtgaacttc
atcggcctcgccggcggtggcggcggcctctcagagaaggtcgcggtccagcgccgctgg
gtccacccgatcaacaacgacgtgcccctcgacgaggctgcgctcatcgagccgctctcc
gtcgcccaccacgccttcgtcgcttcggaggcgaaggaaggcgacgtcgcccttatcggc
ggcgccggcccgatcggcgtgctcaccgctgccgtcgcgaaggcgtacgggtgcaccgtg
atcgtctccgagctgtccgagctgcgccgccggaaggccatcgacgcaggcgtcgccgac
cacgctatcgacccgtccaagcaggacctgaaggaagagatcctgaagctcaccgacggc
aagggcgtcgacgtcgccttcgaggccacctctgtgaacgtggtgctggaccagctcatc
gactgcctgaagctcaagggtaccctcgttgtggagtccatctggtccaagaaggcgcag
tttgacatccacgccctggtgatgaaggagctgaccgtccgcggcatcatcggctacgcc
cacgaccacgagcagaccatcaagctcgtcgaggacggcaaggtcgacctcaagccgttc
atcaccggcaagatcggcttcgacggcgtggtcgacgagggcttcgataccctcatcaac
cgcaacgagaccgcagtgaagatcctggtgtctccggagctctaa

DBGET integrated database retrieval system