KEGG   Corynebacterium ulcerans 05146: Cul05146_0673Help
Entry
Cul05146_0673     CDS       T03420                                 

Definition
(GenBank) Hypothetical protein
Organism
cuz  Corynebacterium ulcerans 05146
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AIU91257
LinkDB All DBs
Position
complement(679072..679833)
Genome map
AA seq 253 aa AA seqDB search
MLFNVIVVLLMIAATTMLITVAFRSDPQKSQDHHEAQEDPHSHTPVAPHEPPLSQEDLAA
SINALQQRFCSAPATERNLAVKDNFSLAPSAVLDLEQLGIEHSHAIELIAQASSTIQTER
HIAVYADNFSFWFTTDGATLLNAHEESATKSTTKPAYRRPHAPISPRKAQKPARRPVPQN
TKEFLLVLKEFGFIVENGKTHYKARHPQHPGRMCAFAKTPSCHRAIHNAISTIRHVFGID
LRAAEPDVRAQAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctttttaacgtcatcgttgttcttttaatgattgctgccacaacgatgctcatcacg
gtggccttccgtagcgatcctcaaaaatctcaagatcaccacgaggcgcaggaagatccc
cacagccatactccggttgcaccacacgagcctcccctttctcaagaagacctggcagca
tccataaatgcacttcaacagcgcttctgctccgcgccagcaaccgagcgcaacctcgcg
gtaaaagacaatttttcccttgcacctagtgccgttctcgatctggaacaacttgggatt
gagcatagccacgctatagaacttattgcccaggctagttccacgatacaaacagagcgt
catatcgctgtctacgccgacaacttttccttttggtttactaccgacggcgctacgttg
ctcaacgcgcacgaagaaagcgctacaaaatcaacaacaaaacctgcttatcgacgcccc
catgcgcctatttccccacgtaaagcacagaaacctgcgcgcagacccgtgccccaaaat
acaaaagaattccttctagttctgaaagaattcggttttatagtcgagaacgggaaaacc
cattacaaggcaagacatccccagcaccccggacgtatgtgtgcctttgccaagactccg
tcgtgccatagagcaatccataatgctatctcgacaatccgacacgtgtttgggattgat
ctacgtgcagcggaacccgatgttagggcacaggctgcatag

DBGET integrated database retrieval system