KEGG   Corynebacterium ulcerans 05146: Cul05146_1032Help
Entry
Cul05146_1032     CDS       T03420                                 

Definition
(GenBank) Hypothetical protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
cuz  Corynebacterium ulcerans 05146
Pathway
cuz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cuz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cul05146_1032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cuz02000]
    Cul05146_1032
Transporters [BR:cuz02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    Cul05146_1032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_16 AAA_25 AAA_22 NB-ARC AAA_29 Gtr1_RagA AAA_7 NTPase_1 RsgA_GTPase AAA_33 AAA_19 PRK AAA_23 MMR_HSR1 TsaE
Motif
Other DBs
NCBI-ProteinID: AIU91606
LinkDB All DBs
Position
1048870..1049520
Genome map
AA seq 216 aa AA seqDB search
MPLLDVSSLSVTYPGAVKPVVKDFDLKVREGEFVGLMGSSGSGKTTIIRSIFGNLPAGTS
VEGTILFSGTPMGAHRWWRDISLVPQSSMSSLNPSFRIGTTIEETCKANNVDFSHRRICE
LLDVVELAPNVAAQFPHELSGGMRQRVCIALALACNPRMVVLDEATTGLDVLVEAHIVAL
LDRLRKHLGLSAILVSHDPRIMSALADSVVSLEESQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgccattgcttgatgtcagtagcctctcagtcacgtatccgggagcggtaaaaccggtg
gtcaaagactttgacctcaaggtaagagaaggcgagttcgtgggcctgatgggaagttcc
ggaagcggaaaaacaacgattattcgctcaatctttggcaacctcccagccggaacgagc
gtcgaggggacaatcctgttttctggcacgccgatgggagcgcatcggtggtggcgtgat
atttcacttgtacctcagtcttcaatgtcatcgttgaatccgtcgtttcgcatcggaacc
accattgaagaaacctgcaaagcaaacaacgtagatttttcgcaccgacgtatctgcgag
cttctcgacgtcgtcgagcttgccccaaacgttgcggcacagtttcctcacgaactttca
ggaggaatgcggcaacgcgtctgcatcgcactcgccctggcctgcaacccccggatggtc
gtgcttgatgaagcaacgacaggtctcgacgtgctggtggaagcacatatcgtggctctc
ctggacaggctgagaaaacatctgggattatcagcgatcctcgtttctcacgatccacgg
attatgagtgctttggcggattctgtcgtctccctcgaggagagccaatga

DBGET integrated database retrieval system