KEGG   Corynebacterium ulcerans 05146: Cul05146_1349Help
Entry
Cul05146_1349     CDS       T03420                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cuz  Corynebacterium ulcerans 05146
Pathway
cuz00010  Glycolysis / Gluconeogenesis
cuz00520  Amino sugar and nucleotide sugar metabolism
cuz01100  Metabolic pathways
cuz01110  Biosynthesis of secondary metabolites
cuz01120  Microbial metabolism in diverse environments
cuz01130  Biosynthesis of antibiotics
cuz01200  Carbon metabolism
Module
cuz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cuz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cul05146_1349 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cul05146_1349 (ppgK)
Enzymes [BR:cuz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cul05146_1349 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AIU91911
UniProt: A0A0M4KTB9
LinkDB All DBs
Position
1404822..1405574
Genome map
AA seq 250 aa AA seqDB search
MTRIGFGIDVGGSGIKGARVDLDTGEFVGDRIKILTPKPATPEAVAQTIFRIVTEAEWEG
PVGITLPSVIRNQVALSAANIDKSWINVDVQKLFTKTLGGRNVAVLNDADAAGIAEVTFG
EEQARRGSAILLTLGTGIGSAFFINGVLFPNTELGHMLVEGKEAEHLASSAAKDREELSY
SKWAKRVSKVLSEYERLFWPDVFIVGGGISRKADKWIPKLTIATPVVPAKLRNTAGIVGA
AMAADQNIRP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacgaattggctttggcattgatgttggtggatctgggattaaaggcgcccgtgtt
gatctggataccggtgaatttgtcggagacaggattaaaattttaacgcccaaacctgcc
acccccgaagcggtcgcccaaacgattttccgcattgttacagaagctgaatgggaagga
ccagtcggaataacgcttccctctgtaatccgaaatcaggtagctctttccgccgctaac
attgacaaatcatggatcaacgttgatgttcagaaactatttacaaaaaccctaggcgga
cgtaacgttgcagtgcttaacgacgccgatgcggcaggcatcgccgaggtcactttcgga
gaagaacaagctcgccgcggctccgccattttgctcactttaggaactggaatcggttcc
gctttctttatcaatggtgtcctattccccaatactgaactaggacacatgctcgtagaa
ggaaaagaagccgagcatctcgcttcatccgcagccaaagaccgtgaagagctaagctat
tccaaatgggccaagcgtgtttctaaagtcctcagcgaatatgaacggctcttttggcca
gacgtatttatcgtaggcggaggaatctcacgcaaagccgataaatggatccctaagctc
actatcgctacacctgtcgtacctgcaaagctacgcaatactgcaggaatcgtaggagca
gcaatggcggctgaccaaaatatccgcccctag

DBGET integrated database retrieval system