KEGG   Corynebacterium ulcerans 05146: Cul05146_2087Help
Entry
Cul05146_2087     CDS       T03420                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cuz  Corynebacterium ulcerans 05146
Pathway
cuz00010  Glycolysis / Gluconeogenesis
cuz00071  Fatty acid degradation
cuz00350  Tyrosine metabolism
cuz00625  Chloroalkane and chloroalkene degradation
cuz00626  Naphthalene degradation
cuz01100  Metabolic pathways
cuz01110  Biosynthesis of secondary metabolites
cuz01120  Microbial metabolism in diverse environments
cuz01130  Biosynthesis of antibiotics
cuz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cuz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cul05146_2087 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Cul05146_2087 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Cul05146_2087 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cul05146_2087 (adhA)
   00626 Naphthalene degradation
    Cul05146_2087 (adhA)
Enzymes [BR:cuz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cul05146_2087 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11 TRAM
Motif
Other DBs
NCBI-ProteinID: AIU92627
LinkDB All DBs
Position
complement(2178797..2179954)
Genome map
AA seq 385 aa AA seqDB search
MVLSPAGVMSVGVQSFRGLNEYSSQQGVGIENAYEKGKIDVKNDFPEAFTAAVVDDFGPE
LTIHDVDLPEPGPNQALVKLVASGICHTDLHAAEGDWPVKPEPPFVPGHEGVGEVVKLGP
GHHGVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYGGYTVDGSFGEYMLVDTRYCA
RIPEGSDPIEVAPILCAGVTVYKGLKETECKPGQYMVISGIGGLGHIAVQYAVAMGMRVI
AVDIADEKLELARKHGAEFAVNALKEDPVEAINAFTKGGAHGVLVTAVHPQAFGQAIGMT
RKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQDLEEALDFYARGMIKPTVTEC
KLDDVNSVFADMHQGKVDGRMAIRY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtccccagccggcgttatgtcggttggggttcagtcatttaggggacttaat
gaatatagttcccaacaaggtgtgggtattgaaaatgcctacgagaaaggaaagatcgac
gtgaaaaacgatttccctgaggccttcaccgctgctgtagttgacgactttggccctgaa
ctcactattcatgatgtagatttgcctgagccgggacccaaccaggcgctggtgaaacta
gtagcttccggcatttgccatacagaccttcacgcagcggaaggcgactggccagtgaaa
ccggaaccaccgtttgtccctgggcatgaaggcgtgggcgaagtcgttaaattagggcct
ggccatcacggagtgcagctcggagatatggtgggcaacgtatggctatggtctgcgtgt
ggggagtgcgagtattgccgcaccggccgcgaaactctttgcaatgacgcggaatatggt
ggctacacggttgatggctccttcggtgaatacatgctggtagatacccgttactgtgct
cgtattccagagggatctgaccccatcgaggttgcaccgatcttgtgtgctggtgtgact
gtatataagggcctcaaagaaactgagtgcaagccgggccagtacatggtcatttctggt
atcggcggtctgggccatatcgctgtgcaatatgcggtagctatgggtatgcgcgtaatt
gcagtggatatcgcggacgaaaaattagagcttgcgcggaaacatggtgctgaatttgca
gtaaatgcgttgaaggaagacccggttgaagcgatcaatgcttttactaagggtggtgcg
catggcgttctggtcaccgccgttcacccgcaagcgttcggtcaagccattggtatgact
cgaaaaggtggaacgatcgtattcaatggtcttcctccaggagagttccctgcacctatc
tttgagattgtgttcaaggggctaaccattcgcggatcgctggtgggaacacgccaggat
ctggaagaagctctcgatttctatgcgcgcggcatgattaagcctactgttacggaatgc
aagcttgacgacgtcaacagtgtctttgccgatatgcatcagggcaaagtcgatgggcgc
atggcgattaggtactaa

DBGET integrated database retrieval system