KEGG   Corynebacterium ulcerans 05146: Cul05146_2289Help
Entry
Cul05146_2289     CDS       T03420                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cuz  Corynebacterium ulcerans 05146
Pathway
cuz00250  Alanine, aspartate and glutamate metabolism
cuz00280  Valine, leucine and isoleucine degradation
cuz00410  beta-Alanine metabolism
cuz00640  Propanoate metabolism
cuz00650  Butanoate metabolism
cuz01100  Metabolic pathways
cuz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cuz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Cul05146_2289 (gabT)
   00650 Butanoate metabolism
    Cul05146_2289 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cul05146_2289 (gabT)
   00280 Valine, leucine and isoleucine degradation
    Cul05146_2289 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cul05146_2289 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cuz01007]
    Cul05146_2289 (gabT)
Enzymes [BR:cuz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Cul05146_2289 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Cul05146_2289 (gabT)
Amino acid related enzymes [BR:cuz01007]
 Aminotransferase (transaminase)
  Class III
   Cul05146_2289 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIU92824
LinkDB All DBs
Position
complement(2414661..2415995)
Genome map
AA seq 444 aa AA seqDB search
MKDLTYRLPQVRKVAEAPGPHSAELDTRRQKAVARALNPGLPGYVVDVDGGVLVDADGNS
WIDFASGIAVTTVGGSNPAVADAVSDAVRRFTHTSFMVSPYESYVAVAEMLAELTPGDHA
KKSVLLNSGAEAVENAIKIARAYTGKQAVIVFDNAYHGRTNLTMAMTAKNKPYKTGFGPL
AGDVFRAPMSYPLRDNKSGAEAAADAIHMIETQIGAENIACLVIEPIQGEGGFIVPAQGF
LPALSQWCTENNVVFVADEIQAGFCRTGEWFACDHEGVVPDLITTAKGIAGGLPLSAVTG
RAEMMDAPVVGGLGGTYGGNPIACAASLAAIAEMKRWDLRQRSRDIEDIVREVLDPLAKE
LDTVAEVRGRGAMVALELVDTHGKPNPDLTGRVAAACKKQGILILTCGIDGNVIRLLPPV
VISESLLREGLGILRDCLREESRR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctcacttaccgtctcccgcaggttcgcaaggtggcagaggcccccgggcca
catagtgccgaactagatacacgcagacaaaaggctgtcgcacgcgcgctcaacccggga
ttgcccggttacgttgtggatgtcgacggaggcgtgcttgtcgacgccgacggtaactcg
tggatcgatttcgcctccggcatcgccgtaaccaccgtcggaggttccaacccggctgtc
gcggatgcagtatccgatgcagtacgacgcttcactcacaccagcttcatggtctccccc
tacgagtcttatgtggcagttgccgagatgcttgcagagctcaccccaggagatcacgca
aaaaagtccgttcttttaaactctggcgcggaagctgtagaaaacgccatcaagattgcc
cgcgcatataccggcaaacaagcggtgatcgtctttgataatgcctatcacgggcgtacc
aaccttacgatggcaatgacagcaaagaacaagccctacaagacagggttcgggcccctg
gcaggagacgtattccgggcgccgatgtcttacccattgcgcgacaacaaaagcggtgcc
gaagccgcagcagatgcgattcacatgattgagacgcagatcggtgcggaaaatattgct
tgtttggtgatcgagcccattcaaggcgagggcggattcatcgtcccagctcagggattt
ttaccagctctttctcagtggtgtacggaaaataacgtagtttttgtcgccgatgagatt
caggctggtttctgtcgcacgggtgaatggtttgcttgcgatcatgagggcgtagtcccg
gacttgatcaccacggcaaaaggcattgcgggcgggcttcccctgtctgcagtcaccgga
cgtgcggagatgatggacgctccagtagtgggcggcctgggcgggacctatggcggaaac
cccattgcctgcgcggcgtcgttagcagctattgcagagatgaagcgttgggatttgcgt
cagcggtcacgagatatcgaggatatcgttcgcgaggtgctcgatcctttggcaaaggag
ctggacacggtcgccgaggttcgcggtcgcggagcaatggtagccctagagcttgtcgac
acccacggaaaacctaatcctgacctcacagggcgagttgctgcggcgtgtaagaagcag
gggatattgatcctgacatgtggaattgacgggaatgtgatccggttgcttccacccgtg
gttataagcgaaagcttgctgcgtgagggcttgggaattctccgtgactgcctacgcgaa
gagtccaggcgatag

DBGET integrated database retrieval system