KEGG   Corynebacterium variabile: CVAR_0951Help
Entry
CVAR_0951         CDS       T01594                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cva  Corynebacterium variabile
Pathway
cva00250  Alanine, aspartate and glutamate metabolism
cva00280  Valine, leucine and isoleucine degradation
cva00410  beta-Alanine metabolism
cva00640  Propanoate metabolism
cva00650  Butanoate metabolism
cva01100  Metabolic pathways
cva01120  Microbial metabolism in diverse environments
Module
cva_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CVAR_0951 (gabT1)
   00650 Butanoate metabolism
    CVAR_0951 (gabT1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CVAR_0951 (gabT1)
   00280 Valine, leucine and isoleucine degradation
    CVAR_0951 (gabT1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CVAR_0951 (gabT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cva01007]
    CVAR_0951 (gabT1)
Enzymes [BR:cva01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CVAR_0951 (gabT1)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CVAR_0951 (gabT1)
Amino acid related enzymes [BR:cva01007]
 Aminotransferase (transaminase)
  Class III
   CVAR_0951 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEK36305
UniProt: G0HD28
LinkDB All DBs
Position
1083856..1085205
Genome map
AA seq 449 aa AA seqDB search
MRNLTHRLPQERRIVTALPGPASTELAQRCSSSVGRAISPSTPGYMVDGDGGVLVDADGN
SFIDLASGIAVTSVGASDEKVVEAIREAAGHFTHTAFMSTPYESYVQVAEKLNEIAPGDH
DKRSVLFSTGAEAVENAVKISRAYTGKSGVVVMDRAYHGRTNLTMAMTAKNRPYKSGFGP
FASDVTRVPMSYPVRDGLTGEGAAARAIYQMEKEVGPENIACVVAEPVQGEGGFIVPAEG
FLPAIAAWCRANDVVFVADEIQAGMCRTGDWFAVNHENVVPDLMTTAKGIAGGMPLSAVT
GRAEIMDAPGVGTLGGTYSGNPVACAAAVAALDQMESQDLAARARGIEQIIREELEPLTS
TGRVAEVRGRGAMVAVELIDADGNPDAALTGSVVTACLAQGVLVLSCGMDGNVLRLLPPL
VIDEALLREGLGVIADAVRTTVGQGAVNA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacctcacccaccggctgcctcaggagcgtcgtatcgtcaccgcgctgccgggc
ccggccagtaccgaactggcacagcggtgcagcagcagcgtcggccgtgcgattagcccc
tccacccccggctacatggtcgatggtgacggtggcgtcctcgtcgacgccgacgggaac
tccttcatcgacctcgcctcgggcatcgccgtgaccagtgtcggtgcctccgacgagaag
gtcgtcgaggcgatccgggaagctgcggggcatttcacccacaccgccttcatgtccacc
ccgtacgagtcctacgtgcaggtcgccgagaagctcaacgagatcgcccccggtgaccac
gacaagcgcagcgtcctgttcagcaccggcgccgaagccgtggagaacgccgtgaagatc
tcccgggcgtacaccgggaagtccggggtcgtcgtcatggaccgcgcctaccacggccgt
accaacctgaccatggcgatgaccgccaagaaccggccctacaagtccggtttcggtccc
ttcgcctccgacgtcacccgcgtgccgatgagctacccggtgcgcgacggactgaccggt
gaaggagcggcggcccgcgccatctaccagatggagaaggaggtcggaccggagaacatc
gcctgcgtcgtcgccgagccggtccagggcgagggcgggttcatcgtcccggccgagggc
ttcctccccgcgatcgcggcctggtgccgcgccaatgacgtggtcttcgtcgccgacgag
atccaggccggcatgtgccgcaccggcgactggttcgccgtcaaccacgagaacgttgtc
cccgacctcatgaccacggccaagggcatcgccggcggcatgccactgtccgcagtcacc
ggtcgcgccgagatcatggatgcaccgggtgtgggcacgctcggcggcacctacagcggt
aacccggtggcctgcgccgccgctgtcgccgccctggaccagatggagtcgcaggacctc
gcggcccgtgcccgggggatcgagcagattatccgcgaggaactggaaccgctcacctcc
accggccgggtcgcggaggtccgtggccgtggcgcgatggtcgccgtggagctcatcgac
gccgacggcaaccccgacgccgcactcacgggctcggtcgtcaccgcctgcctggcccag
ggcgtccttgtcctgagctgtggtatggacggcaacgtcctgcgcctgctgccgccactg
gtcatcgacgaagcgctgctgcgtgaaggcctcggcgtcatcgccgacgccgtgcgcacc
accgtcggacagggggccgtcaatgcctga

DBGET integrated database retrieval system