KEGG   Corynebacterium variabile: CVAR_1579Help
Entry
CVAR_1579         CDS       T01594                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cva  Corynebacterium variabile
Pathway
cva00010  Glycolysis / Gluconeogenesis
cva00520  Amino sugar and nucleotide sugar metabolism
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CVAR_1579 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CVAR_1579 (ppgK)
Enzymes [BR:cva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CVAR_1579 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEK36933
UniProt: G0HEE7
LinkDB All DBs
Position
1805968..1806747
Genome map
AA seq 259 aa AA seqDB search
MTTETAGTTGFGIDIGGSGIKGARVDMDSGEFIGERIKILTPRPATPEAVADVVAELLEQ
AEWDGPVGITVPAVVQNQTALTAANIDHSWIGTDCAELFSRHLAVDGKPREVAVLNDADA
AGLAEARYGDPRAREGAVLLLTFGTGIGSALLVNGTLYPNTELGHLIFPAMDAEKWASSA
VKEREELSYREWARRVDRVLEEYRRILNPQRIIVGGGVSRKFEKWGPHLAVDAEIFPAVL
RNRAGIVGAAGAVRDGIRP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagagacggcaggcacaaccggtttcggcatcgacatcggcggcagcggcatc
aagggggcccgcgtcgacatggactccggtgagttcatcggagagcgcatcaagatcctc
actcccaggcccgccactccggaggccgtcgccgacgtcgtcgccgagcttctcgagcag
gcggagtgggacggaccggtcggcatcaccgtccccgccgtggtccagaaccagacggca
ctgaccgccgcgaatatcgaccactcctggatcggcaccgactgcgccgagctgttctcc
cgacacctcgcggtcgacggcaaaccccgagaggtggccgtcctcaacgacgcggacgcc
gccggactcgccgaggcccgctacggcgacccgcgtgcccgtgaaggcgccgtactgctg
ctgaccttcggcaccggcatcggttcggcgctgctggtcaacggcaccctctacccgaac
accgagctcggtcacctcatcttcccggccatggacgccgagaaatgggcgtcgtccgcg
gtcaaggagcgtgaggaactcagctaccgcgaatgggcccgccgggtcgaccgtgtcctg
gaggagtaccggaggatcctcaacccgcagcgcatcatcgtcggcggcggcgtctcccgg
aaattcgagaaatgggggccgcacctggccgtcgacgccgagatcttccctgccgtactg
cgcaaccgggccggcatcgtcggtgctgccggtgcggtacgcgacggtatccgtccctga

DBGET integrated database retrieval system