KEGG   Corynebacterium variabile: CVAR_2402Help
Entry
CVAR_2402         CDS       T01594                                 

Gene name
tuf
Definition
(GenBank) elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
cva  Corynebacterium variabile
Brite
Translation factors [BR:cva03012]
 Eukaryotic Type
  Elongation factors
   CVAR_2402 (tuf)
 Prokaryotic Type
   CVAR_2402 (tuf)
Mitochondrial biogenesis [BR:cva03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CVAR_2402 (tuf)
Exosome [BR:cva04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CVAR_2402 (tuf)
  Exosomal proteins of breast cancer cells
   CVAR_2402 (tuf)
  Exosomal proteins of colorectal cancer cells
   CVAR_2402 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AEK37747
UniProt: G0HHM7
LinkDB All DBs
Position
complement(2700236..2701471)
Genome map
AA seq 411 aa AA seqDB search
MVARVVATEKSRRTKVAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADTYPDLNQ
AFAFDAIDKAPEERERGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAI
LVVAATDGPMPQTREHVLLARQVGVPYILVALNKCDMVDDEELIELVEMEVRELLAEQDY
DEDAPIVRISALKALEGDPEWTAKIVELMQACDDAIPDPERETDKPFLMPVEDIFTITGR
GTVVTGRVERGSLALNDEVEILGIREKSQKTTVTSIEMFNKLLDSAEAGDNAALLLRGLK
REDVERGQVIAKPGAYTPHKSFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVK
LPEGTDMVMPGDNVDMSVELIQPVAMDEGLRFAIREGGRTVGAGRVTKIND
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcgagagtcgtggccaccgagaagtccaggaggacaaaagtggcgaaggctaag
ttcgagcgcacgaagccccacgttaacatcggcaccatcggtcacgtcgaccacggcaag
accacgacgaccgctgccatcaccaaggttctggctgacacctacccggacctgaaccag
gccttcgccttcgacgccatcgacaaggcgccggaagagcgtgagcgcggcatcacgatc
aacatctcccacgtggagtaccagaccgagaagcgccactacgcccacgtggacgccccg
ggtcacgccgactacatcaagaacatgattaccggtgccgctcagatggacggcgcgatc
ctcgttgtcgccgccaccgacggcccgatgccgcagacccgtgagcacgtcctcctggcc
cgccaggtcggcgtcccctacatcctcgtcgccctgaacaagtgcgacatggttgacgac
gaggagctcatcgagctcgtcgagatggaggtccgcgagctcctcgccgagcaggactac
gatgaggacgccccgatcgtccgcatctccgctctgaaggctctcgagggagacccggag
tggaccgccaagatcgtcgagctcatgcaggcctgcgacgacgccatcccggacccggag
cgcgagaccgacaagccgttcctgatgccggtcgaggacatcttcaccatcaccggccgc
ggcaccgtggtcaccggtcgtgtggagcgtggctccctcgccctcaacgacgaggtcgag
atcctgggtatccgcgagaagtcccagaagaccaccgtcacctccatcgagatgttcaac
aagctgctcgattccgctgaggccggcgacaacgccgccctgctgctccgcggtctcaag
cgcgaggatgtcgagcgcggccaggtcattgccaagccgggcgcctacactccgcacaag
agcttcgagggctccgtctacgtcctgtccaaggacgagggcggccgccacaccccgttc
ttcgacaactaccgtccgcagttctacttccggaccaccgacgtcaccggcgtcgtgaag
ctgccggagggtaccgacatggtcatgcccggcgacaacgtcgacatgtccgtcgagctc
atccagccggtcgccatggacgagggcctgcgcttcgctatccgcgagggtggccgcacc
gtcggcgccggtcgtgtcaccaagatcaacgactag

DBGET integrated database retrieval system