KEGG   Corynebacterium variabile: CVAR_2761Help
Entry
CVAR_2761         CDS       T01594                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cva  Corynebacterium variabile
Pathway
cva00020  Citrate cycle (TCA cycle)
cva00190  Oxidative phosphorylation
cva00650  Butanoate metabolism
cva01100  Metabolic pathways
cva01110  Biosynthesis of secondary metabolites
cva01120  Microbial metabolism in diverse environments
cva01130  Biosynthesis of antibiotics
cva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CVAR_2761 (sdhB)
   00650 Butanoate metabolism
    CVAR_2761 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CVAR_2761 (sdhB)
Enzymes [BR:cva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CVAR_2761 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CVAR_2761 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4 Fer4_9 Fer4_15 Fer4_4 Fer4_2 Fer4_6 Fer4_18 Fer4_21 Fer4_3 Fer4_16 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AEK38100
UniProt: G0HHZ6
LinkDB All DBs
Position
complement(3099210..3099959)
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQADRNAQGHFESVDVPDAVESMSILELLDHVNSSYVEAGKEPFAFASDCRE
GICGTCGLLVNGRPHGPDQNKSACQQRLFSYSDGDALKIEPMRSAAYPVIKDMVVDRSAL
DRVMEKGGFVSIVAGTAPDADHLLVNHHDAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLTLSPLGRMERGRRAKAMVDEVEGTFGPCSLYGECADVCPAGIPLTAVAAITKERA
RAAFKGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcatcttgaaatctggcggcaggcggaccgcaacgcccagggacacttcgag
tccgtggacgtgcccgacgccgtcgagtccatgtccatcctggagcttctcgaccacgtg
aactccagctacgtcgaggcgggcaaggaacccttcgccttcgcctccgactgccgcgag
ggtatctgcggtacctgtggcctcctggtcaacggtcgcccgcacggcccggaccagaac
aagtctgcctgccagcagcgcctgttcagctactctgacggcgacgccctgaagatcgag
ccgatgcgctccgccgcctacccggtcatcaaggacatggtcgtcgaccggtccgcgctg
gaccgtgtcatggagaagggcggcttcgtctcgatcgtcgccggtaccgctccggacgcc
gaccacctcctggtgaaccaccacgacgccgagctcgcgctcgaccacgccgcctgcatc
ggctgcggtgcctgtgtggccgcctgcccgaacggtgccgcgcacctgttcactggcgcg
aagctggtccacctcacgctgtccccgctgggccgcatggagcgtggccgtcgtgccaag
gccatggtcgacgaggtcgagggcaccttcggtccctgctccctctacggcgagtgcgcc
gacgtctgcccggccggcatcccgctgaccgcggtcgccgcgatcaccaaggagcgcgcc
cgcgccgccttcaagggcaaggacgactag

DBGET integrated database retrieval system